SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000019465 from Pelodiscus sinensis 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000019465
Domain Number 1 Region: 153-231
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000968
Family Fibronectin type III 0.0045
Further Details:      
 
Domain Number 2 Region: 245-337
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000143
Family Fibronectin type III 0.0036
Further Details:      
 
Weak hits

Sequence:  ENSPSIP00000019465
Domain Number - Region: 31-121
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00915
Family Fibronectin type III 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000019465   Gene: ENSPSIG00000017240   Transcript: ENSPSIT00000019556
Sequence length 402
Comment pep:novel scaffold:PelSin_1.0:JH211518.1:104747:127337:-1 gene:ENSPSIG00000017240 transcript:ENSPSIT00000019556 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAIVLSIFPILLWTAMASQTNLLEAKGIQVLPPVNFTLTVSALAEVLLQWKPNPGQEQKN
CHVSYDVEILTPESEKYTTNSTHSTRTVVLHNGFSARLQTQLLCNNSKIESNWVTAELQP
PSVTPGWFLLQLKYRDAKTFKNYLILESYKIIINNTASLHCTWLAGQAAPKDTKYFLFYR
YNGYTEECQEYNKDKWGRNIGCQISHTYIKTSGFDQVIIHINGSSKYTAIKPYEQLFDQK
AIEKVNPPRNVTVVLKQNNCLVKWKNPASSLFEQCFEYELNIYNCKRDDQQQILKTKLNS
FSLTIDDTCRNSIQIRANLQSWCGKGFWSDWTEPLYIESNVHLPLTSIVLTALLVFICSM
ALLIAIICRKCHLWRRLFPPIPTPKNSLKNLFLNNNYQVKDI
Download sequence
Identical sequences K7GGQ4
ENSPSIP00000019465 ENSPSIP00000019465

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]