SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000020201 from Pelodiscus sinensis 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000020201
Domain Number 1 Region: 8-174
Classification Level Classification E-value
Superfamily Fibronectin type III 1.75e-16
Family Fibronectin type III 0.0034
Further Details:      
 
Domain Number 2 Region: 187-274
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000464
Family Fibronectin type III 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000020201   Gene: ENSPSIG00000017902   Transcript: ENSPSIT00000020296
Sequence length 274
Comment pep:novel scaffold:PelSin_1.0:JH224631.1:2066768:2073838:-1 gene:ENSPSIG00000017902 transcript:ENSPSIT00000020296 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VEEPLLSKLAVSNATSDSASLTWEAQDDAFDHFVLEVRNSDLPLDSLVHTVPGASRSFVI
TNLRATTNYTVQLHGLVDGQGAQTLTALVTTEAKPQLGTLTLTNVTPDSFNLSWTTQDGP
FAKFVINVRDSYSAHEPQEFMVPGGARSAHISGLVDYTGYDINIQGTTNAGVDTEPLSAF
VVTESMPSLENLTVSDINPYGFTVSWMASENAFDNFLVIVVDSGKLLDPQEFLLTGAQRQ
LELKGLITGIGYEVMLYGFAKGRQTKPLSTVAIT
Download sequence
Identical sequences K7GIU0
ENSPSIP00000020201 ENSPSIP00000020201

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]