SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000020229 from Pelodiscus sinensis 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000020229
Domain Number 1 Region: 368-521
Classification Level Classification E-value
Superfamily PH domain-like 1.91e-54
Family Phosphotyrosine-binding domain (PTB) 0.000000362
Further Details:      
 
Domain Number 2 Region: 535-658
Classification Level Classification E-value
Superfamily PDZ domain-like 7.89e-19
Family PDZ domain 0.0000702
Further Details:      
 
Domain Number 3 Region: 650-732
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000000000276
Family PDZ domain 0.0000329
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000020229   Gene: ENSPSIG00000017923   Transcript: ENSPSIT00000020324
Sequence length 741
Comment pep:novel scaffold:PelSin_1.0:JH212794.1:2190708:2361672:1 gene:ENSPSIG00000017923 transcript:ENSPSIT00000020324 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANRKRQSTTTSMLDHRVIACPTSSHIREPESEENDLPSEEYIAKEAELTTVRGGSPTAV
EQECNDNSGDGDSSSDYVNNTSEEEDYDEGLPEEEEGITYYIRYCPEDDSYLEGMDCNGE
EYVPHEEHQVETDECQEAVEEEWSEANIQHHDESEATEGQDYHDNCVQILEDEVSSLEIQ
DQEENVQYCQNEESYPDYYLPEANGNSHGISPYHLRKEDAELEEQEEDIDQIVAEIKMSM
SMSSINSTTEMSPEYAGTENVQNDYKETCTKGDADHSTNRHEGRPKSLNIPPVSKHAGDM
PRGFKTKSRTPEDRQKWPQEQVCNGLEQPRKQQRSDLNGPVDNNNTSETKKVSSFPSFVD
VPGPCEPEDLIDGIIFAANYLGSTQLLSERNPSKNIRMMQAQEAVSRVKTSEGDSQALTE
VDLFISTQRIKVLNADTQETMMDHALRTISYIADIGNIVVLMARRRMPRSASQDCIETTP
GAQEGKKQYKMICHVFESEDAQLIAQSIGQAFSVAYQEFLRANGINPEDLSQKEYSDIIN
TQEMYNDDLIHFSNSENCKELQLEKQKGEILGVVIVESGWGSILPTVILANMMNGGPAAR
SGKLSIGDQIMSINGTSLVGLPLATCQGIIKGLKNQMQVKLNIVSCPPVTTVLIKRPDLK
YQLGFSVQNGIICSLMRGGIAERGGVRVGHRIIEINGQSVVATAHEKIVQALSNSVGEIH
MKTMPAAMFRLLTGQETPLYI
Download sequence
Identical sequences K7GIW8
XP_006136936.1.96668 ENSPSIP00000020229 ENSPSIP00000020229

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]