SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000020352 from Pelodiscus sinensis 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000020352
Domain Number 1 Region: 233-411
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.87e-24
Family Ankyrin repeat 0.0012
Further Details:      
 
Domain Number 2 Region: 521-630
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00000000000000183
Family Second domain of FERM 0.0033
Further Details:      
 
Weak hits

Sequence:  ENSPSIP00000020352
Domain Number - Region: 422-512
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0393
Family Ras-binding domain, RBD 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000020352   Gene: ENSPSIG00000018002   Transcript: ENSPSIT00000020448
Sequence length 736
Comment pep:novel scaffold:PelSin_1.0:JH206403.1:2363547:2420015:-1 gene:ENSPSIG00000018002 transcript:ENSPSIT00000020448 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNPENIGDAYVAVIRPKNTASLNSREYRAKSYEILLLEVPIEGQKKKRKKVLLETKLQG
SCEITQSILDYVVETTKPISPANQGIKGKRVVLMKKFPLDGEKVGREASLFIVPTVVKDN
TKYTYSPGCPVFYCLQDIMRVCSESSTHFATLTARMLIALDKWLDERHTHSHSIPALFRP
SPLERIKTNVTNPAYAIEPGQTESSLHMGYTALEIKSKMLALEKADTCIYNPLFGSDLQY
TNRVDKVVINPYFGLGAPDYSKIQIPKREKWQRSMSSVMEDKERQWVDDFPLHRSACEGD
SELLSRLLDDNFSVNQLDSDHWAPIHYACWYGKVEATRMLLEKGKCNPNLLNGQLSSPLH
FAAGGGHAEIVQILLNHPEIDRHITDQQRRSPLNVCEESKQNDWEETAKLLKEAINKPYE
KVRIYRMDGSYRSVELKHGNNTTVQQIMEGMRLSQETQQYFTIWICSENLSLQLKPYHKP
LQHVRDWPEILTELTNLDPHRETPQLFLRRDVRLPLEIEKKIEDPLAILILFDEARYNLL
KGFYTSPDAKLITLASLLLQIVYGNYESKKHKQGFLNEENLKSIVPITKLKSKAPHWTNR
ILHEYKSLSTSEGVSKEMHHLQRMFLQNCWEIPTYGAAFFTGQVFTKASSSSHKVIRVYV
GVNVKGLHLLNMETKGLLISLKYGCFMWQLGDADTCFQIHSLENKMSFIVHTKQAGLVIK
LLMKLNSQLMSSERNE
Download sequence
Identical sequences K7GJ91
ENSPSIP00000020352 ENSPSIP00000020352 XP_006114521.1.96668 XP_006114522.1.96668 XP_014424719.1.96668 XP_014424720.1.96668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]