SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000020529 from Pelodiscus sinensis 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000020529
Domain Number 1 Region: 527-660
Classification Level Classification E-value
Superfamily PH domain-like 6.58e-38
Family Pleckstrin-homology domain (PH domain) 0.0025
Further Details:      
 
Domain Number 2 Region: 194-293
Classification Level Classification E-value
Superfamily PDZ domain-like 1.71e-17
Family PDZ domain 0.017
Further Details:      
 
Domain Number 3 Region: 20-74
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000000000611
Family SAM (sterile alpha motif) domain 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000020529   Gene: ENSPSIG00000018155   Transcript: ENSPSIT00000020626
Sequence length 1023
Comment pep:novel scaffold:PelSin_1.0:JH210352.1:453007:784612:1 gene:ENSPSIG00000018155 transcript:ENSPSIT00000020626 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLTFPPFSTFVLVGLDDCLQQYIKNFEREKISGDQLLRITHQELEDLGVTRIGHQELIL
EAVDLLCALNYGLETENLKTLSHKLNASAKNLQNFITGRRRSGHYDGRTSRKLPNDFLTS
VVDLIGAAKSLLAWLDRSPFAAVTDYSVTRNNVIQLCLELTTIVQQDCTVYETENKILHV
CKTLSGVCDHIISLSSDPLVSQSAHLEVIQLTNIKPSEGLGMYIKSTYDGLHVITGTTEN
SPADRCKKIHAGDEVIQVNHQTVVGWQLKNLVNALREDPSGVILTLKKRPQSMLTSAPAL
LKNMRWKPLALQPLIPRSPTSSVATPSSTISTPTKRDSSALQDLYIPPPPAEPYIPRDEK
GNLPCDDIGRHIVGKPVHKGSESPNSFLDQEYRKRFNVVEEDAVLYCYEYEKGRTGGSGR
RESTPTYGKLRPISMPVEYNWVGDYEDPNKIKRDSRRENSLLRYMSNEKIAQDDYMFQRN
SKKDTGKKSKKKGDKNNSPSHYSLLPSLQMDSLRQEVIVTPGPDTTYYHTFQQSSLQQKT
KKKNKAPITGKSKRRISCKDLGRGDCEGWLWKKKDAKSYFSQKWKKYWFVLKDTSLYWYI
NEEDEKAEGFISLPEFKIDRANECRKKYAFKACHPKIKSFYFAAEHLDDMNRWLNRINML
AAGCAERERIKQEQDYWSESDKEEADTPSTPKQDSPPPPYDTYPRPPSMSCASPFVEPKH
SRLSSTETSQSQSSHEEFRQEAVGSTTESPVRKTASQRRSWQDLIETPLTSSGLHYLQTL
PLEDSVFCDSIIISPEHRRQSTLPTQKCHLQDHYGPFPLVEGERKQVLNGNGGKPRSFTL
PRDSGFNHCCQNLSVSASDHQEDVQQKKLEEEEEEGKSSAENQEDKTETIEEKPADSLQD
LYRALEQASLSPLGKYRISTKLEYKKSFLKRCSDPIVNEKLHQLRILKSTLKAREGEVAI
IDKILNNPDLTSKDFQEWKQMYLDLFLDICQNSNPGDPINGSSEVDALIASLAHTHSYIE
THV
Download sequence
Identical sequences K7GJR8
ENSPSIP00000020529 ENSPSIP00000020529

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]