SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000003163 from Pelodiscus sinensis 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000003163
Domain Number 1 Region: 2-77
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 5.64e-21
Family Nuclear receptor ligand-binding domain 0.0000124
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000003163   Gene: ENSPSIG00000003039   Transcript: ENSPSIT00000003176
Sequence length 123
Comment pep:novel scaffold:PelSin_1.0:JH212284.1:47269:48380:-1 gene:ENSPSIG00000003039 transcript:ENSPSIT00000003176 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLEEPEKVDKLQEPLLEALKIYARRRRPNKPYMFPRMLMKITDLRGISTKGAERAITLK
MEIPGPMPPLIREMLENPEMFEDDSSQPPPSADPPSPEESPAEXXXXXXXXXXXXXXXXX
XXX
Download sequence
Identical sequences K7F553
ENSPSIP00000003163 ENSPSIP00000003163

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]