SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000003333 from Pelodiscus sinensis 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000003333
Domain Number 1 Region: 429-658
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 9.95e-43
Family DBL homology domain (DH-domain) 0.00043
Further Details:      
 
Domain Number 2 Region: 132-276
Classification Level Classification E-value
Superfamily PH domain-like 1.03e-41
Family Third domain of FERM 0.00023
Further Details:      
 
Domain Number 3 Region: 786-935
Classification Level Classification E-value
Superfamily PH domain-like 3.22e-33
Family Pleckstrin-homology domain (PH domain) 0.003
Further Details:      
 
Domain Number 4 Region: 32-134
Classification Level Classification E-value
Superfamily Second domain of FERM 3.79e-28
Family Second domain of FERM 0.0001
Further Details:      
 
Domain Number 5 Region: 644-766
Classification Level Classification E-value
Superfamily PH domain-like 2.57e-26
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 
Weak hits

Sequence:  ENSPSIP00000003333
Domain Number - Region: 2-31
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00537
Family First domain of FERM 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000003333   Gene: ENSPSIG00000003188   Transcript: ENSPSIT00000003349
Sequence length 952
Comment pep:novel scaffold:PelSin_1.0:JH210068.1:596918:720383:-1 gene:ENSPSIG00000003188 transcript:ENSPSIT00000003349 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVWLDLLKPIMKQIRRPKHVVVKFVVKFFPPDHAQLQEELTRYLFALQVKQDLAQGRLTC
NDTSAALLISHIVQSETGDFDETIDREHLAKNKYIPQQETLEDKIMEFHRNHIGQTPAES
DFQLLEIARRLEMYGIRLHPAKDREGTKINLAVANTGILVFQGHTKINAFNWAKVRKLSF
KRKRFLIKLRPDVNSSFQDTLEFLMASRDFCKSFWKICVEHHAFFRLFEEPKPKPKPILF
TRGSSFRFSGRTQKQVLDYVKEGGHKKVQFERKHSKIRSIRSLTVQPSEQHSEVPKQSCS
FTFGDNADSPVVQSCRQGKELKASMEDIGQRKSPSLKKSPKEGGKVDGVVMATMEEEEEV
SKDRTQQNRSQSQQPSTAGSLTGSPHLSELSINSQGAPVVANMSLSPNLSPDAKQSSPLV
SPLLNDPSGIRTEEEEEVRRKRFPTDKAYFIAKEVSTTERTYLKDLEVITSWFQSTVSKD
DCMPDTLKNLLFSNFEPLHKFHTSFLKEIEQRLALWEGRSNAHIKGDYQRIGDVMLKNIQ
SMKQLTVHLRKHNEVLMELENGIKNSRKLEALCKDFELQKVCYLPLNTFLLRPLHRLMHY
KQIMERLCKHYPPNHVDFRDSRAALAEISEMVAQLHGSMIKMENFQKLHELKKDLIGIDN
LVIPGREFIRLGSLSKLSGKGLQQRMFFLFNDVLLYTSRGLTASNQFKVHGQLPLYGMTI
EESEEEWGVPHCLTLRGQHQSIIVAASTRAEMDKWTEDIQMAIDLAEKSSGPTPELLASS
PPDNKSPDETTVDQESEDDLSASRTSLERQSPHRGNTTVHVCWHRNTSVSMIDFSIAVEN
QLSGNLLRKFKNSNGWQKLWVVFTNFCMFFYKSHQDNHPLASLPLLGYSLTIPSESENIH
KDYVFKLHFKSHVYYFRAESEYTFERWMEVIRSATSSASRTRVFSHKESHVY
Download sequence
Identical sequences K7F5M3
ENSPSIP00000003333 ENSPSIP00000003333

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]