SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000003973 from Pelodiscus sinensis 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000003973
Domain Number 1 Region: 2-201
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 6.16e-60
Family Nuclear receptor ligand-binding domain 0.0000000169
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000003973   Gene: ENSPSIG00000003756   Transcript: ENSPSIT00000003994
Sequence length 265
Comment pep:novel scaffold:PelSin_1.0:JH211036.1:6212638:6229451:1 gene:ENSPSIG00000003756 transcript:ENSPSIT00000003994 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKQQLLVLVEWAKYIPAFCELPLDDQVALLRAHAGEQLLLGAAKRSMVYKDILLLGNNCI
IHRNSSEVEISRVANRILDELVRPFQEIQIDDNEYACLKAIVFFDPDAKGLSDPLKIKNM
RFQVQISLEDYINDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQLVKLFGMVKIDSLLQ
EMLLGGTSNDVSHLHHPVHPHLAQDPLTGQTILISSMSTPVHTEPISTPETPLPSPPQGS
GQEYKMSTNQATVITQQSILKQKPL
Download sequence
Identical sequences K7F7G3
ENSPSIP00000003973 ENSPSIP00000003973

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]