SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000005860 from Pelodiscus sinensis 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000005860
Domain Number 1 Region: 28-319
Classification Level Classification E-value
Superfamily L domain-like 1.3e-54
Family Ngr ectodomain-like 0.0011
Further Details:      
 
Domain Number 2 Region: 429-497
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000846
Family Fibronectin type III 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000005860   Gene: ENSPSIG00000005447   Transcript: ENSPSIT00000005895
Sequence length 633
Comment pep:novel scaffold:PelSin_1.0:JH209111.1:1559983:1571609:1 gene:ENSPSIG00000005447 transcript:ENSPSIT00000005895 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRLWIMVLVLLWIPVLATTQFPGSAQCPENCSCFFSQWFVRCSNASLSSLPLGIPNATV
ELDLQHNQFSTLSAGFFPELNEISSLYLGSSGICQIEPGAFTGVKTLYHLHLDNNLLEQL
PDGVFQNLTNLIFLHLDHNQITHLPPGVLSSLKQLSVLDLSYNLLLELSDQALHGPLRLR
RLYLSANQITNVSSRALPGSLRALSLDRNQLASVPAAIRASPMLATLQLSGNPIQKLTSL
SFGRRLRSLRQLYLDSLALEQVTSLAFTRLRSLELLSLRNNSLESLPSLFPLKGLSALYL
TGNKWRCDCNLIWLRTWQRKVLRKDRSPVVCSSPAALQGQLLADVELQKLTCPPFGMDPT
TLSPSENSNTPMATAPPRDRPLPGFATTVTTTTSTTQPTTRITSFTVHLATSHHRVLEKW
DPCLADHISSVSIRSKGDSSLVVSWSFSSEHDQFEVRYTSDWGEQVLRVMGGLTEVTLHE
LHAGTEYRVCIIPQNENLPECQTPAARQCIAAHTAGLPHDAQPVHAPLGHSHSAVGIGVA
VALLGLAALALAVTYRLRTRPIQFQRYYDEDESRPHCRSSKPAKMTMYPVDESMEDEDRH
GYMTAASQCPEEKVDGTVRAPPRLMSTPTYVTL
Download sequence
Identical sequences K7FCV0
ENSPSIP00000005860 XP_006124019.1.96668 XP_006124020.1.96668 ENSPSIP00000005860

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]