SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000006565 from Pelodiscus sinensis 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000006565
Domain Number 1 Region: 84-381
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.84e-60
Family Nuclear receptor ligand-binding domain 0.0000251
Further Details:      
 
Domain Number 2 Region: 13-99
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 9.99e-29
Family Nuclear receptor 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000006565   Gene: ENSPSIG00000006035   Transcript: ENSPSIT00000006602
Sequence length 385
Comment pep:novel scaffold:PelSin_1.0:JH208873.1:1101788:1131815:1 gene:ENSPSIG00000006035 transcript:ENSPSIT00000006602 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKPAGSTSRILDIPCKVCGDRSSGKHYGVYACDGCSGFFKRSIRRNRTYVCKSGNQGGC
PVDKTHRNQCRACRLKKCLEVNMNKDAVQHERGPRTSTIRKQVALYFRGHKEENGATPHF
PSAALPAPAFFTAVTQLEPHNLELAAVSTTPERQTLVGLAQPTPKYPHEVNGTPMYLYEV
ATESVCESAARLLFMSIKWAKSVPAFSTLSLQDQLMLLEDAWRELFVLGIAQWAIPVDAN
TLLAVSGMNGDNTDSQKLNKIISEIQALQEVVARFRQLRLDATEFACLKCIVTFKAVPTH
SGSELRSFRNAAAIAALQDEAQLTLNSYIHTRYPTQPCRFGKLLLLLPALRSISPSTIEE
VFFKKTIGNVPITRLLSDMYKSSDI
Download sequence
Identical sequences A0A151MJX7 K7FEV5
ENSPSIP00000006565 ENSPSIP00000006565 XP_005287719.1.60341 XP_006123236.1.96668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]