SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000006825 from Pelodiscus sinensis 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000006825
Domain Number 1 Region: 95-263
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.67e-43
Family Ypt/Rab-GAP domain of gyp1p 0.0048
Further Details:      
 
Domain Number 2 Region: 242-358
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.23e-25
Family Ypt/Rab-GAP domain of gyp1p 0.013
Further Details:      
 
Domain Number 3 Region: 484-545
Classification Level Classification E-value
Superfamily SH3-domain 8.27e-19
Family SH3-domain 0.00082
Further Details:      
 
Domain Number 4 Region: 565-597,631-718
Classification Level Classification E-value
Superfamily RUN domain-like 0.0000000000126
Family RUN domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000006825   Gene: ENSPSIG00000006114   Transcript: ENSPSIT00000006863
Sequence length 753
Comment pep:novel scaffold:PelSin_1.0:JH209111.1:823127:861119:1 gene:ENSPSIG00000006114 transcript:ENSPSIT00000006863 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGNYTPSAGGPFSALTPSIWPQEILAKYTQKEELVEQPEFRYDEFGFRVDKEDGAEPNS
SKLLGIPLTEEPQQRLKWQAHLEFTHNHDVGDLTWDKIEVTLPRSEKLRSLVLAGIPHSM
RPQLWMRLSGALQKKRNSEMSYRDIVKNSSNDETISSKQIEKDLLRTMPSNACFSNMNSI
GVPRLRRILRGLAWLYPEIGYCQGTGMVAASLLLFLEEEDAFWMMCAIIEDLVPASYFST
TLMGVQTDQRVLRHLIVQYLPQLDKLLQEHDIELSLITLHWFLTCFASVVHIKLLLRIWD
LFFYQGSLVLFQVTLGMLSMKEDELIQSENSASIFNTLSDIPSQIEDAEVLLREAMRIAG
SLTDMAVETQRRKHLAYLIADQGQLLNSSTAVNNLSKIVRRRTQRRKSGITSLLFGEDDL
EALKAKNIKQTELVADLREAILQVARHFQCVDPKNCSIDLTPDYTMESHQRDHENYVACS
QNRRRRAKALLDFERHDDDELGFRKNDIITIISQKDEHCWVGELNGLRGWFPAKFVEVLD
ERSKEYSIAGDDSVTEGVMDLVRGTLCPALKSIFEHGLKKPSLLGGPCHPWLFIEEAAGR
EVERDFDSVYSRLVLCKTYRLDEDGKVLTPEELLYRAVQSVNMTHDAAHAQMDVKLRSLI
CVGLNEQVLHLWLEVLCSSLQTVEKWFHPWSFLRSPGWVQIKCELRVLSRFAFSLSQDWE
LPIKREEKEKKPLKEGVQDMLVKHHLFSWDIDG
Download sequence
Identical sequences K7FFL5
XP_006124007.1.96668 ENSPSIP00000006825 ENSPSIP00000006825

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]