SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000007422 from Pelodiscus sinensis 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000007422
Domain Number 1 Region: 1-193
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 8.2e-54
Family BAR domain 0.0014
Further Details:      
 
Domain Number 2 Region: 185-217,249-306
Classification Level Classification E-value
Superfamily SH3-domain 6.48e-18
Family SH3-domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000007422   Gene: ENSPSIG00000006840   Transcript: ENSPSIT00000007463
Sequence length 307
Comment pep:novel scaffold:PelSin_1.0:JH208030.1:894082:925198:-1 gene:ENSPSIG00000006840 transcript:ENSPSIT00000007463 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKQTEVLLQPNPNARIEEFVYEKLDRKAPSRVNNPEQLGQYMIDAGNEFGPGTAYGNALI
KCGETQKRIGTADRELIQTSAINFLTPLRNFIEGDYKTITKERKLLQNKRLDLDAAKTRL
KKAKVAEARAASEQEVRITQSEFDRQAEITRLLLEGISSTHAHHLRCLNDFVEAQMTYYA
QCYQYMLDLQKQLGSFPSTFLSNNNQSSSTPVPSVSASSVLASASASLPSVSNSVVTSGF
SELKSSSGSTKARVLYDYDAANSSELSLLADEVITVYSIPGMDSDWLMGERGNQKGKVPI
TYLQLLN
Download sequence
Identical sequences K7FHB2
XP_014427574.1.96668 ENSPSIP00000007422 ENSPSIP00000007422

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]