SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000007705 from Pelodiscus sinensis 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000007705
Domain Number 1 Region: 698-752
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.62e-17
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 2 Region: 782-837
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000824
Family Classic zinc finger, C2H2 0.038
Further Details:      
 
Domain Number 3 Region: 369-417
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000307
Family Classic zinc finger, C2H2 0.02
Further Details:      
 
Domain Number 4 Region: 535-584
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000109
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 5 Region: 457-508
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000852
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 6 Region: 743-784
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000565
Family Classic zinc finger, C2H2 0.022
Further Details:      
 
Domain Number 7 Region: 827-878
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000614
Family Classic zinc finger, C2H2 0.044
Further Details:      
 
Domain Number 8 Region: 625-675
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000066
Family Classic zinc finger, C2H2 0.035
Further Details:      
 
Weak hits

Sequence:  ENSPSIP00000007705
Domain Number - Region: 48-163
Classification Level Classification E-value
Superfamily SET domain 0.000301
Family Histone lysine methyltransferases 0.049
Further Details:      
 
Domain Number - Region: 187-218
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00781
Family Classic zinc finger, C2H2 0.046
Further Details:      
 
Domain Number - Region: 429-451
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0144
Family Classic zinc finger, C2H2 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000007705   Gene: ENSPSIG00000006944   Transcript: ENSPSIT00000007746
Sequence length 1138
Comment pep:novel scaffold:PelSin_1.0:JH210903.1:1062559:1106914:-1 gene:ENSPSIG00000006944 transcript:ENSPSIT00000007746 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEDGSDETMFIWCEDCGQYHDSECPELGPVVTVKDSFVLSRARSSLPSNLEIRQLEDGT
EGVFAVTQLVKRTQFGPFECKRVAKLEKESAFPLKVFQKDGPLVYFDTSNEDDCNWMMMV
RAATEYEHQNLTAFQHDNDIYFTTSRDIPPGTELRVWYAAFYAKKMEKPVLKQTFNSLFL
HLLVSAPESSEAESSQWTCKVCSVVFPEPQLLTEHLLSHLEQAKGVPQTGQNDAPPEKSS
ETPTADKPVTGESASANVDSRRTPRRGRKPKATKAETPLVIAEAKDPAVDRVAEIITEIP
PDEAALPSAAEERIMELVLGKLPSTTNNISTVTKFSHHQNTMSLKRSLILSSRHGIRRKL
IKQLGEHKRVYQCNICSKIFQNSSNLSRHIRSHGDKLFKCEECAKLFSRKESLKQHVSYK
HSRNEVDSDYRYKCATCEKAFRIESALEFHNCRTDDKTFQCEMCFRFFSTNSNLSKHKKK
HGDKKFACEICNKMFYRKDVMLDHQRRHMEGVRRVKREDFEHNTENMVRYKKEPSGCPVC
GKVFSCRSNMNKHLLTHGDKKYTCEICGRKFFRVDVLRDHIHVHFKDIALMDDHQREEFI
GKIGISSEENDDNSDESADSEPHKYSCKRCQLTFGRGKEYLKHIMEVHKEKGYGCSICNR
RFALKATYHAHMVIHRENLPDPNVQKYIHPCEICGRIFNSIGNLERHKLIHTGVKSHACE
QCGKSFARKDMLKEHMRVHDNIREYLCAECGKGMKTKHALRHHMKLHKGIKEYECKECHR
KFAQKVNMLKHYKRHTGIKDFMCELCGKTFSERNTMETHKLIHTVGKQWTCSVCDKKYVT
DYMLQKHIQLTHDKVEAQSCQLCGTKVSTRASMSRHMRRKHPEVLSVRIDDLEQLPEATT
IDASSIGIVQPELTLEQGELPESRQMKAPKRGHKRKQKPGEEEEVQVPEDPAFSEYTEKE
AEFTGNVGDETNSAVQSIQQVVVTLGDPNVTAPSSSVGLTNITVTPITTAAGTQFTNLQP
VAVGHLSTPERQLQLDNSILTVTFDTVSGSAMLHNRQNDIQIQPQPEAANPQSVAHFINL
TTLVNSIAPLGNQIAEQHPLTWRAVPQTDVLQPPSQQIQQQSGQQQVQTEQQQQMYSY
Download sequence
Identical sequences K7FI45
ENSPSIP00000007705 ENSPSIP00000007705

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]