SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000008235 from Pelodiscus sinensis 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000008235
Domain Number 1 Region: 11-241
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 3.66e-76
Family BAR domain 0.0000000537
Further Details:      
 
Domain Number 2 Region: 268-352
Classification Level Classification E-value
Superfamily SH3-domain 2.36e-23
Family SH3-domain 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000008235   Gene: ENSPSIG00000007506   Transcript: ENSPSIT00000008278
Sequence length 356
Comment pep:novel scaffold:PelSin_1.0:JH224677.1:1443615:1469282:1 gene:ENSPSIG00000007506 transcript:ENSPSIT00000008278 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FFNSQVYMFFHKFLQLFSEKISGAEGTKLDEEFQEMERKIDVTSKAVAELLSKSTEYLQP
NPAYRAKLGMLNTMSKIRGQVKTTGYPQTEGLLGDCMLRYGRELGEDSTFGIALIDAGEC
MKQMAEVKDSLDINVKQNFIDPLQLLQDKDLKEIGHHLKKLEGRRLDYDYKKKRLGKIPD
EEVKQAVEKFEESKELAERSMFNFLENDIEQVSQLAVFIEAALDYHKQSTEILEELQSTL
QNRINGASSRPKREFKPKPIITSALEVSDNQQHNGISYSSSIKLSAGAGSSAHMDQPCCQ
ALYDFEPENEGELGFKEGDIITLTNQIDENWYEGMLNGESGFFPINYVEVMVPLPQ
Download sequence
Identical sequences K7FJM5
ENSPSIP00000008235 ENSPSIP00000008235

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]