SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000009053 from Pelodiscus sinensis 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000009053
Domain Number 1 Region: 205-300
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000175
Family Eukaryotic type KH-domain (KH-domain type I) 0.0035
Further Details:      
 
Domain Number 2 Region: 94-158
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000114
Family Eukaryotic type KH-domain (KH-domain type I) 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000009053   Gene: ENSPSIG00000008263   Transcript: ENSPSIT00000009099
Sequence length 581
Comment pep:novel scaffold:PelSin_1.0:JH211329.1:352743:368693:-1 gene:ENSPSIG00000008263 transcript:ENSPSIT00000009099 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGRPFPSSADGVSAVAGSESSAAPSGALDAAAAVAAKINAMLMAKGKLKPTANTTDKLQ
APGKGPATSKSKDDLVVAEVEINDVPLTCRNLLTRGQTQDEISRLSGAAVSTRGRFMTVE
EKAKVGPGDRPLYLHVQGQTRELVDRAVNRIKEIITNGVVKAATGSSPTFNGATVTVYHQ
PAPIAQLSPAVGQKPPFQSGMHYVQDKLFVGLEHAVPTFNVKEKVEGPGCSYLQHIQIET
GAKVFLRGKGSGCIEPASGREAFEPMYIYISHPKPEGLAAAKKLCENLLQTVHAEYSRFV
NQITTAVPLAGFTQPAAINSLPPQPSYYPANGYQSGYPVPPPQQPVQPPYGVPGIVPPAV
PLAPGVLTIPPGVPPVPTQYPISQVQPPASTGQSPLSGPFLPSAPVKTALPTATPPQVQP
QPQGQGQKRRFTEELPDERESGLLGYQHGPIHMTNLGTGFSSQSEIDEAGSKPASSSGKE
RERDRQLMPPPAFPVTGMKTESEERNGSGSLLGNHDHSAKKMKTAEKGFGLVSYTGDSSD
EEEEHGGHKNASNFSQGWSLGYQYPSSQQRAKQQMPFWMAP
Download sequence
Identical sequences K7FLZ3
ENSPSIP00000009053 XP_006132110.1.96668 ENSPSIP00000009053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]