SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000009409 from Pelodiscus sinensis 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000009409
Domain Number 1 Region: 386-581
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 6.03e-68
Family Nuclear receptor ligand-binding domain 0.0000144
Further Details:      
 
Domain Number 2 Region: 104-194
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.22e-29
Family Nuclear receptor 0.0000159
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000009409   Gene: ENSPSIG00000008488   Transcript: ENSPSIT00000009456
Sequence length 583
Comment pep:novel scaffold:PelSin_1.0:JH212176.1:6961419:6982658:-1 gene:ENSPSIG00000008488 transcript:ENSPSIT00000009456 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSLHSFLSLPPGGVIAYISSSSASSPASCHSESSESSFQSSSSPVPSSPNSSSSESSYN
SRSSEGSDGASKNDRMDSAVKTSRSSAAGLTKGHGGLTKFNGMVLLCKVCGDVASGFHYG
VHACEGCKGFFRRSIQQNIQYKKCLKNNNCSIMRMNRNRCQQCRFKKCLSVGMSRDAVRF
GRIPKREKQRMLIEMQSAMKTMMNSQFNGHLPNDALTEHQEQTPPLSQEELIPKPQHELE
NIKSPSPPPSSDIAKEEVIGMVTRAHKDTFMYNQEQSENPVEAMQPQSGKRIPKHPEQYT
LNSDHCGSGLSDTQYIESEQHLAGQYKGTNVTHYPNGRTVCFANGHSLNFSNGYTQGMCD
RIPEDGFSANENLNIYSCNTGGRMHLVCPMSKTPFVDPLKSGHEVWEEFSMSFTPAVKEV
VEFAKRIPGFRDLSQHDQVNLLKAGTFEVLMVRFASLFDAKERTVTFLSGKKYRVDDLHS
MGAGDLLNSMFEFSEKLNGLQLSDEEMSLFTAVVLVSADRSGIENVNSVEALQETLIRAL
RTLIMKNHPNEASVFTKLLLKLPDLRSLNNMHSEELLAFKVHP
Download sequence
Identical sequences K7FMZ9
ENSPSIP00000009409 XP_006134400.1.96668 ENSPSIP00000009409

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]