SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000009892 from Pelodiscus sinensis 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000009892
Domain Number 1 Region: 86-191
Classification Level Classification E-value
Superfamily Second domain of FERM 1.44e-32
Family Second domain of FERM 0.0000885
Further Details:      
 
Domain Number 2 Region: 189-327
Classification Level Classification E-value
Superfamily PH domain-like 1.17e-30
Family Third domain of FERM 0.0027
Further Details:      
 
Domain Number 3 Region: 14-84
Classification Level Classification E-value
Superfamily Ubiquitin-like 7.03e-22
Family First domain of FERM 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000009892   Gene: ENSPSIG00000008947   Transcript: ENSPSIT00000009942
Sequence length 571
Comment pep:novel scaffold:PelSin_1.0:JH211347.1:4054683:4259239:1 gene:ENSPSIG00000008947 transcript:ENSPSIT00000009942 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQRGECYIRANSIRVAVDKKRDAKGQYLFDLLCHHLNLLEKDYFGIRFVDPDKQRHWLEF
TKSVVKQMRAQPPFTMCFRVKFYPTDPAALKEEITRYLVFLQIKRDLYHGRLLCKTSDAA
LLAAYILQAEIGDYDPGKHPEGYSSKFQFFPKHSEKLERKIAEIHKTELSGQTPATSELN
FLRKAQTLETYGVDPHPCKDVSGNAAFLAFTPFGFVVLQGNKRIHFIKWNEVTKMKFEGK
TFYLYVSQKEEKKIVLTYFAPTPEACKHLWKCGIENQAFYKLGKLSRRPGATRSPLIGSG
SRFRYSGRGHQQVDREASSSRREPPPNRRGAHLGWTRPELQTLSRQPALGVQGELRVPQL
RQIRPRQTLGKGGPLAGLESLRDSAHSTPVRSASHSDAFLPPVRSSRVDSSERVAIISDE
IYSPADSVLPTPVAEHSLELMLLSRQINGAPCSIEEEKESEANTPTATEADEMRGEFKAL
CQGVGGTGGTQATQVNKFVLSVLRLLLVTVGLLFVLLLLLIILTESDLDVAFFRDIRQTP
EFEQFHYQYFCPLRRWFACKVRSVLSLLIDT
Download sequence
Identical sequences K7FPD2
ENSPSIP00000009892 ENSPSIP00000009892

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]