SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000010044 from Pelodiscus sinensis 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000010044
Domain Number 1 Region: 306-544
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.54e-63
Family Nuclear receptor ligand-binding domain 0.000000192
Further Details:      
 
Domain Number 2 Region: 50-133
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.79e-29
Family Nuclear receptor 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000010044   Gene: ENSPSIG00000008995   Transcript: ENSPSIT00000010095
Sequence length 555
Comment pep:novel scaffold:PelSin_1.0:JH207675.1:660085:680204:-1 gene:ENSPSIG00000008995 transcript:ENSPSIT00000010095 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPALLCQDIPSSAYCCNSGCFHYPPQGPAATAFAVELLASGRSCLSQIEVIPCKICGDKS
SGIHYGVITCEGCKGFFRRSQQGNVTYSCTRQQNCQIDRTSRNRCQHCRLQKCLSLGMSR
DGKMFRFWLENIEKWHQEKNFFLQKRVFGHEPFTLKAPTAGGEGASTPASSLGLANGQLK
LAPSPDLLESSACSTALLSGQARLSQSPDETAALAYPTGLAKGHSRLSDNLRGPFTREYS
PERIKMESRASVFYTLEMQASPDLARLDIGGGKRGQAGGDVGEAVDFYTSPNFTSILESP
NSSVTEIEHLTQNVLKSYRETCQLRLEDLQLLRLETFSWEEVRSYQKKSMEEMWERCACR
ITEAIQYVVEFAKRMGGFMELCQNDQIVLLKAGAMEVVLVRMCRAFNSENRTVFFEGKYA
GPELFKSLGCNELINSIFDFAHSLCSLHFSENEIALFTALVLINSSRPWLQEKDKVERLQ
NNLELAFKHMLRKTHRESILAKLPPKGKLRSLCYQHMEKLRSFRQMYPIIVHAVFPPLYK
ELFSSECELQGAAAE
Download sequence
Identical sequences K7FPT4
ENSPSIP00000010044 ENSPSIP00000010044

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]