SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000010331 from Pelodiscus sinensis 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000010331
Domain Number 1 Region: 491-656
Classification Level Classification E-value
Superfamily A middle domain of Talin 1 2.22e-70
Family A middle domain of Talin 1 0.00000032
Further Details:      
 
Domain Number 2 Region: 756-891
Classification Level Classification E-value
Superfamily I/LWEQ domain 1.94e-53
Family I/LWEQ domain 0.00000199
Further Details:      
 
Domain Number 3 Region: 661-785
Classification Level Classification E-value
Superfamily I/LWEQ domain 1.22e-51
Family I/LWEQ domain 0.00000443
Further Details:      
 
Domain Number 4 Region: 2296-2486
Classification Level Classification E-value
Superfamily I/LWEQ domain 5.59e-51
Family I/LWEQ domain 0.00011
Further Details:      
 
Domain Number 5 Region: 1840-1974
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 7.3e-47
Family VBS domain 0.00000689
Further Details:      
 
Domain Number 6 Region: 1227-1363
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 4.47e-42
Family VBS domain 0.024
Further Details:      
 
Domain Number 7 Region: 197-311
Classification Level Classification E-value
Superfamily Second domain of FERM 7.07e-32
Family Second domain of FERM 0.0000013
Further Details:      
 
Domain Number 8 Region: 1075-1209
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 2.35e-28
Family VBS domain 0.014
Further Details:      
 
Domain Number 9 Region: 312-402
Classification Level Classification E-value
Superfamily PH domain-like 9.99e-25
Family Third domain of FERM 0.0000172
Further Details:      
 
Domain Number 10 Region: 1472-1557
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.0000000000000327
Family I/LWEQ domain 0.0087
Further Details:      
 
Domain Number 11 Region: 2006-2133
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.000000022
Family VBS domain 0.01
Further Details:      
 
Domain Number 12 Region: 1698-1816
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.000000173
Family VBS domain 0.063
Further Details:      
 
Domain Number 13 Region: 81-135
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000104
Family Ubiquitin-related 0.062
Further Details:      
 
Domain Number 14 Region: 948-1044
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.0000302
Family I/LWEQ domain 0.004
Further Details:      
 
Weak hits

Sequence:  ENSPSIP00000010331
Domain Number - Region: 1588-1661
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.00157
Family VBS domain 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000010331   Gene: ENSPSIG00000008923   Transcript: ENSPSIT00000010383
Sequence length 2542
Comment pep:novel scaffold:PelSin_1.0:JH209891.1:445648:756576:1 gene:ENSPSIG00000008923 transcript:ENSPSIT00000010383 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVALSLKICVRQCNVVKTMQFEPSTAVYDACRVIRERVPEAQTGQASDYGLFLSDEDPRK
GIWLEAGRTLDYYMLRSGDILEYKKKQRPQKIRMLDGSVKTVMVDDSKTVGELLVTICSR
IGITNYEEYSLIQESIEEKKEEGTGTLKKDRTLLRDERKMEKLKAKLHTDDDLNWLDHSR
TFREQGVDENETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFEKACEF
GGFQAQIQFGPHVEHKHKPGFLDLKEFLPKEYIKQRGAEKKIFQEHKNCGEMTEIEAKVK
YVKLARSLRTYGVSFFLVKEKMKGKNKLVPRLLGITKDSVMRVDEKTKEVLQEWPLTTVK
RWAASPKSFTLDFGEYQESYYSVQTTEGEQISQLIAGYIDIILKKKQSKDRFGLEGDEES
TMLEESVSPKKSTILQQQFNRTGKVEHGSVALPAVMRSGSSGPETFNIGSMPSPQQQVMI
GQMHRGHMPPLTSAQQALMGTINTSMHAVHQAQSDLNEVDNLPPLGQDMASRMWVQNKVD
ESKHEIHSQVDAITAGTASVVNLTAGDPVDTDYTAVGCAITTISSNLTEMSKGVKLLAAL
MDDEVGSGEDLLKAARTLAGAVSDLLKAVQPTSGEPRQTVLTAAGSIGQASGELLRQIGE
NETDERFQDVLMSLAKAVANAAAMLVLKAKNVAQVAEDMVLQNRVIAAATQCALSTSQLV
ACAKVVSPTISSPVCQEQLIEAGKLVDRSVENCVRACQAATDDSELLKQVSAAASIVSQA
LNDLLQHVRQFASRGEPIGRYDQATDTIMCVTESIFSSMGDAGEMVRQARVLAQATSDLV
NAMRSDAEAEIDMDNSKKLLAAAKLLADSTARMVEAAKGAAANPENEDQQQRLREAAEGL
RVATNAAAQNAIKKKIVNRLEIAAKQAAAAATQTIAASQNAAVSNKNTVAHQQLVQSCKN
VADHIPQLVQGVRGSQAQAEDLSAQLALINSSQNFLQPGSKMVASAKAAVPTVSDQAAAM
QLSQCAKNLATSLAELRTASQKAHEACGPMEIDSALNTVQTLRNELQDAKMAALDGQLKP
LPGETLEKCAQDLGSTSKAVGSSMAQLLTCAAQGNEHYTGVAARETAQALKTLAQAARGV
SASTTDPVAAHAMLDSARDVMEGSAMLIQEAKQALVAPGDAESQQRLAQVAKAVSHSLNN
CVNCLPGQKDVDVALKSIGESSKKLLIDSLPPSSKSFQEAQSELNQAAADLNQSAGEVVH
ATRGQSGELAAASGKFSDDFDEFLDAGIEMAGQAQTKEDQIQVIGNLKNISMASSKLLLA
AKSLSVDPGAPNAKNLLAAAARAVTESINQLITLCTQQAPGQKECDNALRELETVKGMLD
NPNEPVSDLSYFDCIEGVMENSKVLGESMAGISQNAKIGDLLVFGECVGVASKALCGLTE
AAAQAAYLVGISDPNSQAGHQGLVDPIQFARANQAIQMACQNLVDPASSPSQVLSAATIV
AKHTSALCNACRIASSKTANPVAKRHFVQSAKEVANSTANLVKTIKALDGDFSEDNRNKC
RIATAPLIEAVENLTAFASNPEFVSVPAQISMEGSRAQEPILISAKTMLESSALLIKTAR
SLAINPKDPPTWSVLAGHSHTVSDSIKSLITSIRDKAPGQRECDYSIDGINRCIRDIEQA
SLAAVSQNLATRDDISVEALQEQLTSVVQEIGHLIDPIATAARGEAAQLGHKVTQLASYF
EPLILAAVGVASKMLDHQQQMTVLDQTKTLAESALQMLYAAKEGGGNPKASHTHDAITEA
AQLMKEAVDDIMVTLNEAASEVGMVGGMVDSIAEAMNKLDEGTPPDPKGSFVDYQTTVVK
YSKAIAVTAQEMMTKSVTNPEELGGLASQMTNDYGHLALQGRMAAATAEPEEIGFQIRTR
VQDLGHGCIFLVQKAGALQICPTDGYTKRELIECARAVTEKVSLVLSALQAGNKGTQACI
TAASAVSGIIADLDTTIMFATAGTLNAENNESFADHRENILKTAKALVEDTKLLVSGAAS
SPDKLAQAAQSSATTITQLAEVVKLGAASLGSDDPETQVVLINAIKDVAKALSDLIGATK
GAASKPADDPSMYQLKGAAKVMVTNVTSLLKTVKAVEDEATRGTRALEATIECIKQELTV
FQSKEVPEKTSSPEESIRMTKGITMATAKAVAAGNSCRQEDVIATANLSRKAVADMLTAC
KQASYHSDVSEDVRARALRFGTECTLGYLELLEHVLLILQKPTPELKHPLAALSKRVAGA
VTELIQAAEAMKGTEWVDPEDPTVIAETELLGAAASIEAAAKKLEQLKPRAKPKQADETL
DFEEQILEAAKSIAAATSALVKSASAAQRELVAQGKVGAIPANAADDGQWSQGLISAARM
VAAATSNLCEAANASVQGHASEEKLISSAKQVAASTAQLLVACKVKADQDSEAMRRLQAA
GNAVKRASDNLVRAAQKAAFRKADDDDVVVKTKFVGGIAQIIAAQEEMLKKERELEEARK
KLAQIRQQQYKFLPTELREDEG
Download sequence
Identical sequences K7FQM1
ENSPSIP00000010331 XP_006127396.1.96668 XP_006127397.1.96668 XP_006127398.1.96668 XP_006127399.1.96668 XP_006127400.1.96668 XP_006127401.1.96668 XP_014431119.1.96668 ENSPSIP00000010331

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]