SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000015642 from Pelodiscus sinensis 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000015642
Domain Number 1 Region: 366-426
Classification Level Classification E-value
Superfamily BPTI-like 1.25e-20
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0038
Further Details:      
 
Domain Number 2 Region: 239-302
Classification Level Classification E-value
Superfamily BPTI-like 1.11e-18
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0033
Further Details:      
 
Domain Number 3 Region: 317-357
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000144
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 4 Region: 153-241
Classification Level Classification E-value
Superfamily PKD domain 0.000000128
Family PKD domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000015642   Gene: ENSPSIG00000013890   Transcript: ENSPSIT00000015716
Sequence length 518
Comment pep:novel scaffold:PelSin_1.0:JH210322.1:1668796:1704938:1 gene:ENSPSIG00000013890 transcript:ENSPSIT00000015716 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GGGEKSRAQAPSAYWEGLIQLLTAAVLGQEEGEEGASFGETCLAHFTTGMADFVLDTDAS
VQNGATFLLSPPHKRGKECVRACCKHPHCNLALVEQDPAGGEDSIQACFLLDCLYEQTFV
CKFARKEGFLNYVKREVYDAYVDMREEGHGDDKPPIARVGMDMKVQPQEPVLLRGAESTD
DHGIVRYDWKLLLGDTSVVLKKDNDEVELSNLQEGVYVFQLTVTDSADQQDSTNITITVL
TAEQTEEFCLAPKKVGRCRGSFPRWFYNPESQQCERFTFGGCKANKNNYVWEEACKLACK
NVQGSSGERAQPVCNGSCQPFHFKCKDGCCIDSYLECDETSDCADGSDEADCEMYALEFN
RLRKINVTTEQSRCVDLPDIGLCQDSIPRWYYNPFTEKCDRFTYGGCEGNQNNFEEEEEC
LKSCEGITSKQGSYGVREPASLPLRDSLPSPEPCGFEVAIAVVLCICIMIVLVIIGYFFL
KNRKKNSRRRQPATATNSTLSTTEDTEHLVYNSTTKPI
Download sequence
Identical sequences K7G5T1
ENSPSIP00000015642 ENSPSIP00000015642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]