SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000017463 from Pelodiscus sinensis 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000017463
Domain Number 1 Region: 22-379
Classification Level Classification E-value
Superfamily L domain-like 5.1e-62
Family Ngr ectodomain-like 0.0052
Further Details:      
 
Domain Number 2 Region: 525-605
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000594
Family Fibronectin type III 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000017463   Gene: ENSPSIG00000015545   Transcript: ENSPSIT00000017542
Sequence length 706
Comment pep:novel scaffold:PelSin_1.0:JH211635.1:1205236:1207623:-1 gene:ENSPSIG00000015545 transcript:ENSPSIT00000017542 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XXXXXXXXXXXXXXXXXXXXXLCTNRGLRVVPKAADPQGILTYSLGGNFIANISAFDFHR
LAVLQRLDLQYNRIRWLHPKAFERLVLLEELYLGNNRLVALAPGTLRSLAKLRILYVNAN
EISRLSSTTFTGLGSLVKLRLDGNVLGSLGEATFSGLPNLLYLHLESNHIRWLSRGTFVG
LTKLRFLDLSSNQQSSLRYPDTFGPLRSLSTLLLSSNNLQQLGGGLFQHLPGLAKLSLSS
NRLVQLAPDAFAGLGLLKELQLDGNLLSHLPATLLEPLHSLEVLDLSRNVLAALHPAAFG
HLPKLRELSLRDNALAALPGELFTSSLALQRLELDGNAWRCDCHLWGLKHWLGTWHSQGR
LLTVFVQCRLPPALAGKYLDYLQDAQLLPPDGTTCHDWASLSPSLPPAIGQWPREQQWQP
ITVPERFRGNSSHSPVRLGPDSLPSASTMHFLDTQEGPAPARGSGRAKPTPTASLTNLLA
GSKPPPPLAGPAWPRRAGKHHLSPSLAGAPLVSDPCDFNKLFLCNLSVETVSTSSVTVHW
GVRPHRSPRLLGPVRFRLLFDRFGATVKFQRFVYLAEHSAPSATLQELHPDTPYLVCVEG
ILGGRVCPVAPRDHCVGLVTLSEGGTAGGPDQQLLTLVLLAVNAMLLFVALAAWASRLVR
KKVQGRRQAAPGFVQWHPGTTVWGWSPCLRGAQLAAQTSNSSHWCC
Download sequence
Identical sequences K7GB02
ENSPSIP00000017463 ENSPSIP00000017463

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]