SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000017641 from Pelodiscus sinensis 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000017641
Domain Number 1 Region: 677-872
Classification Level Classification E-value
Superfamily Sec7 domain 1.7e-76
Family Sec7 domain 0.00000156
Further Details:      
 
Domain Number 2 Region: 434-617,1176-1524
Classification Level Classification E-value
Superfamily ARM repeat 1.13e-26
Family HspBP1 domain 0.095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000017641   Gene: ENSPSIG00000015444   Transcript: ENSPSIT00000017720
Sequence length 1838
Comment pep:novel scaffold:PelSin_1.0:JH211036.1:873249:1038076:-1 gene:ENSPSIG00000015444 transcript:ENSPSIT00000017720 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFLTRALEKILADKEVKKAHHSQLRKACEVALEEIKAETEKQSPPHGEAKPGSSTLPPVK
SKTSFIEADKYFLPFELACQSKCPRIVSTSLDCLQKLIAYGHLTGNAPDSTAPGKKLIDR
IIETICGCFQGPQTDEGVQLQIIKALLTAVTSQHIEIHEGTVLQAVRTCYNIYLASKNLI
NQTTAKATLTQMLNVIFARMENQALQEAKQMEKERHRQQHHLQQSPVSHHESESPQLRHL
PAQTVDQLPQENEELDHSTNDVDKSLQEDTEAENGSDISSAENEQTEADQAAAAETLSKN
DVGIYGENNECEEKAQDIVQSIVQEMVNIIVGDVEGIAESGSADGTIGTLEDGSDSENIQ
ANGIPGTPISVAYTPSLPDDRLSVSSNDTQESGNSGPTPGAKFSHILQKDAFLVFRSLCK
LSMKPLSDGPPDPKSHELRSKILSLQLLLSILQNAGPVFRTNEMFINAIKQYLCVALSKN
GVSSVPEVFELSLSIFLTLLSNFKTHLKMQIEVFFKEIFLYILETSTSSFDHKWMVIQTL
TRICADAQSVVDIYVNYDCDLNAANIFERLVNDLSKIAQGRGSQELGMTNIQELSLRKKG
LECLVSILKCMVEWSKDQYVNPNSQTTLGQEKPTEQDSNETKHPETINRYGSLNSLDSTA
SSGIGSYSTQMSGTDNPEQFEVLKQQKEIIEQGIDLFNKKPKRGIQYLQEQGMLGTTPED
IAQFLHQEERLDSTQVGEFLGDNDKFNKEVMYAYVDQHDFSGKDFVSALRMFLEGFRLPG
EAQKIDRLMEKFAARYLECNQGQTLFASADTAYVLAYSIIMLTTDLHSPQVKNKMTKEQY
IKMNRGINDSKDLPEEYLSAIYNEIAGKKISMKETKELAIPTKSSKQNVASEKQRRLLYN
LEMEQMAKTAKALMEAVSHVQAPFTSATHLEHVRPMFKLAWTPFLAAFSVGLQDCDDTEV
ASLCLEGIRCAIRIACIFSIQLERDAYVQALARFTLLTVSSGITEMKQKNIDTIKTLITV
AHTDGNYLGNSWHEILKCISQLELAQLIGTGVKPRYISGTVRGREGSFTGTKDQAPDEFV
GLGLVGGNVDWKQIASIQESIGETSSQSVVVAVDRIFTGSTRLDGNAIVDFVRWLCAVSM
DELLSATHPRMFSLQKIVEISYYNMGRIRLQWSRIWEVIGDHFNKVGCNLNEDVAIFAVD
SLRQLSMKFLEKGELANFRFQKDFLRPFEHIMKRNRSPTIRDMVVRCIAQMVNSQAANIR
SGWKNIFSVFHLAASDQDESIVELAFQTTGHIVTIVFEKHFPATIDSFQDAVKCLSEFAC
NAAFPDTSMEAIRLIRHCAKYVSDRPQTFKEYTSDDMNVAPEDRVWVRGWFPILFELSCI
INRCKLDVRTRGLTVMFEIMKTYGHTYEKHWWQDLFRIVFRIFDNMKLPEQQTEKAEWMT
TTCNHALYAICDVFTQYLEVLSDVLLDDIFAQLYWCVQQDNEQLARSGTNCLENVVILNG
EKFTLEIWDKTCNCMLDIFKTTIPHALLTWRPTGGESSPVSPSSVREKQLDTISQKSVDI
HDAVQPRSSDRHQIQPIVGSTASEEISKIRPTAKFPEQKLFAALLIKCVVQLELIQTIDN
IVFFPATSKKEDAENLAAAQRDAVDFDVHVDTQDQGMYRFLTSQQLFKLLDCLLESHRFA
KAFNSNNEQRTALWKAGFKGKSKPNLLKQETSSLACGLRILFRMYMDESRTGAWDEVQQR
LLNVCSEALSYFLTLTSESHREAWTNLLLLFLTKVLKISDERFKAHASFYYPLLCEIMQF
DLIPELRAVLRRFFLRIGVVFQISQPPEQELGTSRSKH
Download sequence
Identical sequences K7GBI0
ENSPSIP00000017641 ENSPSIP00000017641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]