SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000019210 from Pelodiscus sinensis 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000019210
Domain Number 1 Region: 854-936
Classification Level Classification E-value
Superfamily DEATH domain 5.72e-23
Family DEATH domain, DD 0.00000865
Further Details:      
 
Domain Number 2 Region: 155-246
Classification Level Classification E-value
Superfamily Immunoglobulin 7.19e-16
Family I set domains 0.02
Further Details:      
 
Domain Number 3 Region: 245-296
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000144
Family TSP-1 type 1 repeat 0.00064
Further Details:      
 
Domain Number 4 Region: 299-353
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000115
Family TSP-1 type 1 repeat 0.00059
Further Details:      
 
Domain Number 5 Region: 48-150
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000166
Family I set domains 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000019210   Gene: ENSPSIG00000016884   Transcript: ENSPSIT00000019300
Sequence length 944
Comment pep:novel scaffold:PelSin_1.0:JH208383.1:285311:448491:1 gene:ENSPSIG00000016884 transcript:ENSPSIT00000019300 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPASARSRAGLLLLALALHCNFGRCGAGIEYSDVLPDSFPSAPAETLPHFLLEPQDAYIV
KNKPVELICRANPATQIYFKCNGEWVNQNDHLTKESLDEVTGMLVREVQIEVSRQQVEEL
FGLEDYWCQCVAWSSAGTTKSRRAYVRIAYLRKNFDQEPLGKEVPLEQEVLLQCRPPEGV
PPAEVEWLRNEDVIDTTQDTNFLITIDHNLIIKQARLSDTANYTCVAKNIVAKRRSTTAT
VIVYVNGGWSTWSEWSQCNNRCGRGWQKRTRTCTNPAPLNGGSFCEGQPFQKIACTTMCP
VDGAWTEWSKWSACSTECTHWRSRECTAPSPKNGGKDCSGVLLDSKNCTDGLCMQNKRVL
SEPKNHLLESTGDVALYAGLVVAIFVLIVILMAVGVVVYRRSCRDFDTDITDSSAALTGG
FHPVNFKTSRHDNPQLLHPSMQPDLTANAGVYRGPMYALQDSSDKIPMTNSPLLDPLPNL
KIKVYNSSTASSSPRLNDGADLLGAVPTGTYPGDSPRDNHFMNLRNKAAGSQHLLTLPRE
HGNSATGTFGCLGGRLTIPDTGVSLLVPHGAIPQGKFYEMYLLINKAENTLLPSEGTQTV
LSPMVTCGPTGLLLCRPVILTIPHCADISSSDWIFQLKTQSHQGNWEEVVTLDEETLNTP
CYCQLETKSCHVLLDQLGTYVFVGESYSRSAIKRLQLAIFAPTVCTSLEYNLKVYCLEDT
PDALKEALELEKTLGGYLIEEPKPLLFKDSYHNLRLSIHDIPHSLWKSKLLAKYQEIPFY
HIWSGSQRALHCTFSLERYSLASTELTCKICVRQVEGEGQIFQLHTTLGENASSFDAFCL
HHGSSVTTQLGPYAFKIPLSIRQKICNSLDAPNSRGNDWRLLAQKLSMDRYLNYFATKAS
PTGVILDLWEAQHQDDGDLNTLASALEEMGKSEMLVVMATEGDC
Download sequence
Identical sequences K7GFZ9
ENSPSIP00000019210 XP_006121549.1.96668 ENSPSIP00000019210

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]