SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000019355 from Pelodiscus sinensis 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000019355
Domain Number 1 Region: 216-230,415-629
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.88e-63
Family Nuclear receptor ligand-binding domain 0.0000566
Further Details:      
 
Domain Number 2 Region: 148-229
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.46e-29
Family Nuclear receptor 0.000099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000019355   Gene: ENSPSIG00000017190   Transcript: ENSPSIT00000019446
Sequence length 641
Comment pep:novel scaffold:PelSin_1.0:JH207385.1:3729664:3834435:1 gene:ENSPSIG00000017190 transcript:ENSPSIT00000019446 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATIEELAHQIIEQQMGEIAHSQGTITQTLMDGTAQRIQIVPADSGLSLPQRIQIVTDQQ
TGQKIQIVTALDQNTAGKQFILTNHDGSTPSKVILARQDSTPGKVFLTTPDAAGVNQLFF
ASPDLSAQHIQILTDNTSTEQSLNKVFDLCVVCGDKASGRHYGAVTCEGCKGFFKRSIRK
NLVYSCRGAKDCVINKHHRNRCQYCRLQRCIAFGMKQDSVQCERKPIEVSREKSSNCAAS
TEKIYIRKDLRSPLAATPTFVTDNETARSTGLLESGMFVNIHQSGIKSEPTVLMTQDKVE
ACQGDLSTLANVVTSLASLSKSKDMSQSSAELSMIESLSNGDTSLSELHQEEQASSDVTR
AFDTLAKALNPGESAACQSSAESIEANVHLIGGETSMNIVEIEGPLLSDAHVAFRLTMPS
PMPEYLNVHYICESASRLLFLSMHWARSIPSFQALGQDNSISLVKACWNELFTLGLAQCS
QVMNVATILTAFVNHLHGSLQQDKLSTDRGKLVMEHIFKLQEFCNSMVKLCLDGYEYAYL
KAIVLFSPDHPGLENVIQIEKFQEKAYMEFQDYVTKAYPDDTYRLSRLLLRLPALRLMSA
NITEELFFAGLIGNVQIDSIIPYILRMETADYNSQIIGHSV
Download sequence
Identical sequences K7GGE4
ENSPSIP00000019355 XP_006118365.1.96668 ENSPSIP00000019355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]