SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000019721 from Pelodiscus sinensis 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000019721
Domain Number 1 Region: 135-295
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.1e-47
Family Nuclear receptor ligand-binding domain 0.000098
Further Details:      
 
Domain Number 2 Region: 6-35
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000336
Family Nuclear receptor 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000019721   Gene: ENSPSIG00000017480   Transcript: ENSPSIT00000019814
Sequence length 296
Comment pep:novel scaffold:PelSin_1.0:JH209956.1:308403:313406:1 gene:ENSPSIG00000017480 transcript:ENSPSIT00000019814 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RCQAGTGMCPVDKAHRNQCQACRLKKCLQAGMNKDGEGRAGGPTCSPATGGGLPAGSPVW
ALTVQSHVFLAYLAQSEHIPRARSGGLSVCPSVALLRPLPVTVNFLMHPTPVHHLHHTVH
RTPTLLHLYPPTPYTRQVILLEEAWSELFLLCAIQWSMPLESCPLLSVPELSPHTHGKLV
SASGDVRILQETIARFKALTIDPAEFACMKAIVLFKPETRGLKDPEQVENLQDQSQVMLD
QHNRTHYPSQPVRFGKLLLLLPSLRFISSDRIELLFFRRTIGNTPMEKLLCDMFKN
Download sequence
Identical sequences K7GHG0
ENSPSIP00000019721 ENSPSIP00000019721

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]