SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000020473 from Pelodiscus sinensis 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000020473
Domain Number 1 Region: 149-442
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.29e-82
Family Nuclear receptor ligand-binding domain 0.000000015
Further Details:      
 
Domain Number 2 Region: 46-133
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.04e-28
Family Nuclear receptor 0.0000085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000020473   Gene: ENSPSIG00000018108   Transcript: ENSPSIT00000020570
Sequence length 447
Comment pep:novel scaffold:PelSin_1.0:JH224667.1:487786:536788:1 gene:ENSPSIG00000018108 transcript:ENSPSIT00000020570 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQLQDCWEFYQDGAAHVLDAVSEMELLEASTPLPDPASEFDRNVPRICGVCGDKATGFH
FNAMTCEGCKGFFRRSMKRKAMFTCPFNSDCKITKDNRRHCQACRLKRCVDIGMMKEFIL
TDEEVQRKRELITRRKEEEALKESMKPKLSEEQQRVIDVLLEAHRKTYDPTYSDFTQFRP
PVRASASNRMATRSSSVLTHGSSSEDSSDTFSSSPVSTLSPPESFEHRMFSSMALSEDSD
ASPSMDMSLSHLSMLPHLADLVSYSIQKVIGFAKMIPGFRDLMAEDQIALLKSSAIEIIM
LRSNQSFSLEDMAWSCGGNEFKYQVTDVTQAGHSLELLEPLVKFQIALKKLSLHEEEHVL
LMGICILSPDRPGVQDTALVEVLQTYILCKHPPPGNRLLYAKMIQKLADLRSLNEEHSKQ
YRCLSFKPEHSMQLTPLGLEVFGNEIS
Download sequence
Identical sequences K7GJL2
ENSPSIP00000020473 ENSPSIP00000020473

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]