SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T000045 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T000045
Domain Number 1 Region: 332-402
Classification Level Classification E-value
Superfamily SMAD/FHA domain 0.0000000000000475
Family FHA domain 0.0035
Further Details:      
 
Domain Number 2 Region: 210-277
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000824
Family Variant RING domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T000045
Sequence length 476
Comment protein Name="PYU1_T000045" Note="Similar to MARCH1: E3 ubiquitin-protein ligase MARCH1 (Homo sapiens)" AED:0.0290223079775077 QI:0|0.33|0.25|0.75|1|1|4|287|476
Sequence
MSGSNDRRWSLARATEFFSGDGKPDMLDIRGMTAVTKGATGKRDKFRKNVSRCGVSIYGP
KHSQSTEVNSAGGAREKIFIEDPRAPCLNIDYSNDAYRLLPSSEKFSAHTGVCQILGTKC
IRGGKHRIKVGDIIRFGSVGLLVTEIDTGGIGPNDACLSTSEVNSLIQRVVCHDEAMVDA
DSGMDTDDDAGEASGNDESKPRASQQRQSTSAICYVCYDESEDDNPLISPCKCSGDTKYI
HLNCLKRWNTNGEKNEICTVLDESNARTCSICKAPYPSKTRLPSGKSISLLPDRLNPPNI
MFQVVTKHSSSTLNLSTRYQLSYKMLMDNDIHRPLMVGRSSQCDLVLKYRTVSTIHAEIH
YAKGEFFLKDAGSSNGTLRYIYRPLTLHNNQSLHVKFGRTVLSIKPTKKIRLPHFFSSNN
HVHSNNNSRIENSLHEDDDEVSHSTPSNTRSRFHNTPQQQPQNPQTIQSQLQNLEL
Download sequence
Identical sequences K3W504
PYU1_T000045

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]