SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T000055 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T000055
Domain Number 1 Region: 93-181
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 7.74e-24
Family Canonical RBD 0.0000908
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T000055
Sequence length 184
Comment protein Name="PYU1_T000055" Note="Similar to RBM8A: RNA-binding protein 8A (Bos taurus)" AED:0.106498785767078 QI:0|0|0|1|1|1|2|215|184
Sequence
MADEVDYESDTAMTMEEEEDVKHEAKSSSRSSGRRVVMQQSSSSSSSSGRRVVKGRGKGS
AAMDAERYPDESGVFEKLNIRGDTSRNHDTALKSVEGWILFVSGVHEEAQEEDILDAFGA
DAPVKNLHLNLNRRTGFVKGYALVEFESFEDAKAAMEAMDGEEILGSTIHVDWAFRKAKR
EQQW
Download sequence
Identical sequences K3W514
PYU1_T000055

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]