SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T000066 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T000066
Domain Number 1 Region: 382-476
Classification Level Classification E-value
Superfamily Homeodomain-like 3.95e-29
Family Myb/SANT domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T000066
Sequence length 814
Comment protein Name="PYU1_T000066" Note="Similar to TTLL1: Probable tubulin polyglutamylase TTLL1 (Bos taurus)" AED:0.223142093080743 QI:0|0|0|0.5|1|1|4|0|814
Sequence
MQQMKAETQEDLPREHQATSDAEVQQRHGDEGERQPTREHEHIIERAQDAIDALRKELVT
KLSQRGTESAREAGDENASRGRSGIMRVDVHAAPVSNVAAVSAVPTSPIEVLMKKMHELV
QKYNHKDSERASEVATSIVARDAPALGVAVVSDSASMVDELARLQRKVTEQALALNQLKA
HDAARQIESDHLRKSVLSLQQDLMRLMNIVELQMQMPAVHTPMLANAFPGRHLQQHQHMY
HQHQQHRAPTMGMTNPGYYHRGAMKQPRAAVGSSTVQMTPMTDASLLTRRFMDADRKKRA
CMFGDALPTTSVTAFSQNVQERHQLLVRHPSDATPALVSPHETVFANASGIFTHESLSPQ
QKRIKTSKSNGNGRSGTNSKLGKRPWSVEEDQTLAMAVESSGASDWSAISRILPGRCGKQ
CRERWVNHLSPSVNKDAWTQHEDEIIFRTREQIGNHWADIARLLPGRTDNAVKNRFYSTM
RRRIRQQRSSNNNTSHSVKTAHHSHPSRHSDLYHHSPSKQDETMLPATTSTSEYQHNRDN
RDEGEGAYANRSSSHGTSSTTSGASSVTSSPASMQQDEQEDDEDAETGDTSATSFRSQHE
PEMEVATTASSSSKTSSAKFKWRVDAEKHVVVWNFERRGWVKTEGDDWNVYWANKTTIKA
MFNPESAGSARLVDGQYVNHFPNHYELTRKDLLVKNIKRYKKEANSASASSSLNGPGASG
ATPATQSLAANVNATSMQPPPSAMYSAASATGGTGGIAATVVTNAETLDFLPITYTLPAD
YSLFVEEFRRNPNAMWIMKPCSKAQGKGIFIVWK
Download sequence
Identical sequences K3W525
PYU1_T000066

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]