SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T000095 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T000095
Domain Number 1 Region: 58-153
Classification Level Classification E-value
Superfamily Homeodomain-like 1.68e-27
Family Myb/SANT domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T000095
Sequence length 444
Comment protein Name="PYU1_T000095" Note="Similar to MYB: Myb proto-oncogene protein (Homo sapiens)" AED:0.113065735587525 QI:0|0|0|1|1|1|3|0|444
Sequence
MEPPSVVYPDALFTDSSNNAIDNDNAHDGHQDEQQDETQQDAYDETDAYDTACHAPHARR
QQWSRRDDLVILQFVRECGTKRWAKIADLLPGRTPKQCRTRWLNFLDPTIDKAPWRADET
ELIFAAQEQMGNKWAEIAKLLPGRTDNAIKNHWYSTYRRHRRQAAKQRGSAAAKAVSNAP
LSPSQANFSSRSSAAAKEKRKIPKPHKLTVDSHERCAMLSSPMSVSSPDARHGVQFHNFP
AVSPLGGTPSLRSHPLYASPSLMSPPTMAPQFQFPGASFFPRSPLPDLLLSPPSITTGFS
FYPPRGESLLFDLQATAPAPSLQNHQSAWQDLGFTLTDSDSNSDCGASPSSTKPTICMQQ
STGSIQVEETSLGMLLPPKEGASNPTMFNSDSDTSGVCVGRSRVALLRKEEETTRKRSDS
ADLFLDCVELLSTKKKHTKHTSLL
Download sequence
Identical sequences K3W554
PYU1_T000095

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]