SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T000100 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T000100
Domain Number 1 Region: 68-270
Classification Level Classification E-value
Superfamily Bet v1-like 1.19e-16
Family STAR domain 0.011
Further Details:      
 
Domain Number 2 Region: 272-349
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000197
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T000100
Sequence length 424
Comment protein Name="PYU1_T000100" Note="Similar to Hrs: Hepatocyte growth factor-regulated tyrosine kinase substrate (Drosophila melanogaster)" AED:0.194849573417153 QI:0|0|0|0.5|1|1|2|0|424
Sequence
MPIKSSTPKWKKFHCPPLSPARMTQITQEANVACDELLKFSAGEVFGTGSANHDDDDGAQ
HIPEELKWEFAEQVDSIRVEKVRVRSSEKQKKSVFYFRGLTHMEASLDEVVELYEVDMEH
PNVQLESKLSPDLLHSVILYEIKPYDFHDSTMFIGIRWSAMRSPYVLVRNRDYCFLEIQR
RFTLPDGRRGFARCFHSVKIKSCPDMEKTHGFVRGSIYRSGFVFTENPRDRRTLDVVQAT
YADLKGNVPKWVSTAGLRQRVMNLEHLKKYVNMRRVANQTFARRSQMMAPEKVKTCFVCV
DDIGTFQRRYNCQKCGEVICGRCRVTIQADIAVVGKMKLTICSLCSLAINRTILPDSGGS
SGSRSADGHRPFSVMPVMMYTNRQSSESEDVTASQRKRALSLNSFHTANFDQTSLFSSNR
SHEV
Download sequence
Identical sequences K3W559
PYU1_T000100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]