SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T000145 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T000145
Domain Number 1 Region: 33-144,189-376
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 1.64e-62
Family Regulator of chromosome condensation RCC1 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T000145
Sequence length 466
Comment protein Name="PYU1_T000145" Note="Similar to HERC3: Probable E3 ubiquitin-protein ligase HERC3 (Homo sapiens)" AED:0.0575825589847356 QI:0|0|0|1|0|0|2|0|466
Sequence
RVPSETHSYELCLVGNLRDFGYAHPGAHTVHGIPVHVDAAIVQVSCGVGWLCFLTANGRA
YSCGINTYGQLGQGHLDTGLITPAPLLMPSTQRIARISCGTCHGGIVTKSGALFTFGCGS
YGRLGTGDTSNRATPTQVHMRWSALHLEAKTVQAAVHAGIPVVKILPAPASRVPSSSGPA
SGIEETSSNDDEVILTDISCGDRHTLVLGAKELATTGSSANMHAPPSKTSIISFGDGMHG
RLGIGNEKDQLTGALISTFIAPQYAKGVTPTIAAVSAGVAHSAALTSSGELFTWGNGAAG
QLGHGDSCNSEWCPRQVDHFKHIPLVSVKCGAQHSIAVSRTGAVYTWGRNKEGQLGQGGL
HIASPSNRSQPQRVHLAVDPMAIQQMQLNAQMQAAAVTASDSTTVSAPQHQLQQQDLCVA
VRHIVAKEHFCMALDEQSRLFINLVALFLRGKQHNAAPEEVSTSMG
Download sequence
Identical sequences K3W5A4
PYU1_T000145

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]