SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T000149 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T000149
Domain Number 1 Region: 197-302
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.42e-25
Family Canonical RBD 0.0014
Further Details:      
 
Domain Number 2 Region: 90-196
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 6.99e-25
Family Canonical RBD 0.0014
Further Details:      
 
Domain Number 3 Region: 3-74
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.000000000000148
Family Canonical RBD 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T000149
Sequence length 413
Comment protein Name="PYU1_T000149" Note="Similar to SPBC23E6.01c: Uncharacterized RNA-binding protein C23E6.01c (Schizosaccharomyces pombe)" AED:0.0220588235294117 QI:0|1|0.66|1|1|1|6|318|413
Sequence
MDAECKTLWMGDIQMHWDEAFISSLFAATGEQPVVKLIRDKVTGYPAGYGFLEFPTQRGA
QLVLETYNGQVIPNTLHRFRMNWGAGGRRIETGDDHSVFVGDLAPDVSDELLLTTFSTRF
SSVRGAKVVIDPVTRMSKGFGFVRFGNKEEADQALQTMNGVYCSSRPMRVSVATDRNGKP
RSGNQVYGAGGMGNTEEEGANTTVFVGGLDPSTTEEELRARFGAIGDIVSVKVPPGRGCG
FVQYTTKEAAEVAIGQMNGTVIGGVKVRCAWGRSAAVRAAAAAGGAGGYYQQYPNYQQSG
YQNYYGYGGYYPQYQQVGGYGGYGGYGSYDQQGSQQHGGYQQHGHGHQSHHGGHHGHHRH
QEPRDFTRPDDIDAMNRRYASQRAYQHMPPAANASYSSMSSDVTKGTAMAGSM
Download sequence
Identical sequences K3W5A8
PYU1_T000149

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]