SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T000155 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T000155
Domain Number 1 Region: 116-225
Classification Level Classification E-value
Superfamily Bet v1-like 0.00000000522
Family STAR domain 0.027
Further Details:      
 
Domain Number 2 Region: 245-310
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000921
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T000155
Sequence length 452
Comment protein Name="PYU1_T000155" Note="Similar to TPRXL: Putative protein TPRXL (Homo sapiens)" AED:0.225911653629308 QI:0|0|0|0.5|1|1|4|0|452
Sequence
MFEPSLAATTDQYSIRFAPDPLRDLEREKLVTLGHREFADLFATIRFARSSGFGTKVRSS
ARSTRATICVPTQIHATLEEVADVFFSDRTNAAIGFAASQQIYSLVEPSDERPLRACGLR
WSLWHSPSKLVRQRDILYIEYMDTFVDENGRRGWARVTRSIHHRSCPPLLHSHNVVRAHL
GCSGTTYTETDTPGVLDVVTLYDCDTKGVPAWLTKFVAVRKAKNAHLLEHLIRLARAAND
SLVADFTKLVPAKQEKACVGCGDALPKWNVGGRKCRECKENVCKSCSDIVYCAVEGGKKL
NRICMHCVDRYLSTDVERSRVDMYTQLSTSSSSSSSRPRKASSYDESAPSNGSTRRRRSR
SSNSHSGSTDGADLDSPLPMLEDKPSSFPPSAPSSADSRQYGLRERAATQAARKQPPKLL
NLGVSRYRERKPPSGDIDLSYLASFKTVSSRS
Download sequence
Identical sequences K3W5B4
PYU1_T000155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]