SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T000156 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T000156
Domain Number 1 Region: 74-231
Classification Level Classification E-value
Superfamily Bet v1-like 0.000000000288
Family CoxG-like 0.088
Further Details:      
 
Domain Number 2 Region: 227-326
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000576
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T000156
Sequence length 462
Comment protein Name="PYU1_T000156" Note="Similar to adcA: Arrestin domain-containing protein A (Dictyostelium discoideum)" AED:0.196544276457883 QI:0|-1|0|1|-1|1|1|0|462
Sequence
MANRYRYSRSPDQPYAVDLHPLPAAEASALIHKAFTAFRKLFAAIQIAKHDDSDVARVAS
VSGDDGDNHQHSSSKSVMVCTSGLVYGTLEEVAALYVHDDSRMVLDFPDSKRLYTLAEPS
KASPMRCAGVRWSRWKSTSKLVSDRDMIYVEYMDTFTDPVAGRRGWARCTKSIVHPVCPE
SQHPDGPVRAQLHCSGIIMHETDTYGELEATLLVHMDTQGMPAFVAQKALNSRKKSLQHI
NHVLKLTRQMSGTPQSDDDMVLGGGSLTGDERACRSCNEHVSKWTRVRHCRYCDATLCKP
CALISYNQAADKEENPKTTRMCVDCGTGKKPRPVNGTGIAEDRPLSPSALAALSLQRPHV
YSKGRVNSSRSIDTESSVGSAREDTDELRHQRLRHASSVSSTSTTAQASQPGLQRMNSRQ
RGASNSSDMGSFRLAPAVKMDLSYLNDIVSAKPKASSNTESQ
Download sequence
Identical sequences K3W5B5
PYU1_T000156

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]