SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T000159 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T000159
Domain Number 1 Region: 31-192
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 6.8e-26
Family Dual specificity phosphatase-like 0.025
Further Details:      
 
Domain Number 2 Region: 438-645
Classification Level Classification E-value
Superfamily DNA ligase/mRNA capping enzyme, catalytic domain 9.21e-26
Family RNA ligase 0.044
Further Details:      
 
Domain Number 3 Region: 220-369
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000708
Family Shikimate kinase (AroK) 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T000159
Sequence length 655
Comment protein Name="PYU1_T000159" Note="Similar to Dusp23: Dual specificity protein phosphatase 23 (Mus musculus)" AED:0.15769514500438 QI:0|-1|0|1|-1|1|1|0|655
Sequence
MSTLVYPSREKLWTVAQAGPSTFYKLPRFFRWVVPFQLAAMSTPRNGDDIRHLALPVGIH
HIVTLTEEEPLPREWFAGLLSHVMRHTFLPVENYKVPTLAQIDLFMRICTEAVESGPVLV
HCGGGKGRAGVMLACYLVAFGWRAPPSDLSLWMQPAMSADQAIESLRVLRPGSIETEIQE
AIVRSYSSLLWKRQAVLPIPVDEPMISRPIVSGEPIDKTDLLVLCGLPGSGKTTFRRLVV
KRTVAASTHMSPSDRPVRGGPAPWTGLSGDEHGRQGCERSIGLKGIQRAILDHVNGKAED
RKYFIKLASTWSTHATAVWFDFESELCIYRAQRRSDHPSLPPGRRVENAVQQHAREFEPP
TLSEGFRGIVRVTSIEAAQELALLLAPPLPLLKFPRTPHAINLGAATDDDLIMADPFPQV
TRRAVPSPSGAASTPCATSTTRIVITEKVDGANLGISLSPDGYKFVVQNRSHYIASSSHP
QFRKLDTFLEAHRDTLMAILKQDKLFPDRFILYGEWLAAKHSIPYSNLNDWFYAFDLFDR
EEHRFWDRASFVALVTAANNQTASLSVADPILIVPELWSGTELPARDTLIQMAQQTRSHF
YDGVIEGLYIKWEAPDHVQQRGKVVRADFICGNEHWTKNIIQFNTVVPQEPRYGS
Download sequence
Identical sequences K3W5B8
PYU1_T000159

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]