SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T000167 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T000167
Domain Number 1 Region: 93-192
Classification Level Classification E-value
Superfamily Ribosomal protein S3 C-terminal domain 5.49e-26
Family Ribosomal protein S3 C-terminal domain 0.0017
Further Details:      
 
Domain Number 2 Region: 10-99
Classification Level Classification E-value
Superfamily Prokaryotic type KH domain (KH-domain type II) 1.81e-23
Family Prokaryotic type KH domain (KH-domain type II) 0.0000322
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T000167
Sequence length 237
Comment protein Name="PYU1_T000167" Note="Similar to RPS3A: 40S ribosomal protein S3-1 (Arabidopsis thaliana)" AED:0.024745143959223 QI:0|-1|0|1|-1|1|1|0|237
Sequence
MAQNISKKRKFVADGVFYAELNELLQRELSGEGYAGVEVRVTPMRTEIIIRATRTQEVLG
EKGQRIRALTSVVQKRFNFPDGAVELYAERVANRGLCSQAQAESLKYRLLGGLAVRRACY
SVIRFVMEAGAKGVEVIVSGKLRAQRAKAMKFKEGYMVKTGNAGQEYVDTAVRHVLMRQG
VLGVKVSIMLPHDPTGKQGPKRNLDDVVTILEPKEEVYRPYVEPTVNVVPVAAPADL
Download sequence
Identical sequences K3W5C6
PYU1_T000167

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]