SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T000186 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T000186
Domain Number 1 Region: 277-349
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000000576
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0057
Further Details:      
 
Domain Number 2 Region: 151-250
Classification Level Classification E-value
Superfamily Bet v1-like 0.000000159
Family STAR domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T000186
Sequence length 393
Comment protein Name="PYU1_T000186" Note="Similar to ZK632.12: Uncharacterized protein ZK632.12 (Caenorhabditis elegans)" AED:0.0687022900763359 QI:0|-1|0|1|-1|0|1|0|393
Sequence
MARPTPHTGAATWTPLRENYFATPLLSAKEKTYLVRKSCEAAQEVVERARSRGGPVQWRH
IEKYQDVQIYAGQPRGAFGSQSQSADIMSMCGVTSVAASVKEIAALFDLSTTRSMKEFSM
DNRELFYDAIVLYNLSPRTKEKPLHQVTAKWITVKCPRGVEDRDFCYLECQDKFVDSTGR
KGWVMCLHSIKLPGCNELTREFGFVRGSFYHSGVIVVETDRPGYVDVIHMLQINFKKNTR
VSPSFMRDRVAFVAKIRTMMRDKRLNEQRYLNDLELVPKKYRSRCTVCQDSFTLLLLRKM
NCRKCGEVVCGACSKEFDVKNARFMETVKIRVCMQCFQLITTVSKSAQIPMLEQSRQSTA
MSFLGYYEDEQRASFMTQVTSSAAELAETSANR
Download sequence
Identical sequences K3W5E5
PYU1_T000186

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]