SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T000193 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T000193
Domain Number 1 Region: 94-236
Classification Level Classification E-value
Superfamily Bet v1-like 1.1e-33
Family STAR domain 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T000193
Sequence length 562
Comment protein Name="PYU1_T000193" Note="Similar to STARD6: StAR-related lipid transfer protein 6 (Homo sapiens)" AED:0.134103019538188 QI:0|0.33|0|0.5|1|1|4|0|562
Sequence
MKLLSELERSWAMFSATWKVVDLFGGMQIWQQQPSVETPSTEPLNGMLLSTSSAGLVAFL
AGSIGGGGLITAVLLCVLVVAAALWTMTAKRVKGDVPCFKTMKVIDGTPSEIFLYLMNVK
NYPMWDASIEKADVVHTIDDHSDIIHIVYRSAWMWPVWVTPRDLCLLRYWRRAEDGSYVI
CLQSAIHPECPPTHGIIRAKCDGGGFIISPRGAGLAHTEELTSMVAHVIHMDPQGWEGKL
LQRLNSLHVYLRPQILALTGLQEVMDARKYVSPNVPEEFSAAMASAEEASAAAMAALGAQ
HMGEGESGGSGSGAAGGKAPAIALQDFPCNVPRSMWAEPDGGTVLVRGPDYLTDRRKIPS
APPAFRLVGIDLFNSSSSIEHIASRPDNVVQKELKRHEEQGTEMPFTFVINFVVPGNPCI
SLVLYYQAPHPSVLTDGSPFADLMADFLEGTDEFRDERFKLIPCIVEGSFIVRQAVGSTP
AIVGKKLRQPYYHGKQYFELDVDIGSSAVANRVVGLVSGYTKKLVIDMGFLIEGQRSDEL
PERLFGSCRLVHIDLGIAAKLD
Download sequence
Identical sequences K3W5F2
PYU1_T000193

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]