SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T000212 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T000212
Domain Number 1 Region: 2-271
Classification Level Classification E-value
Superfamily Bet v1-like 6.04e-90
Family Phoshatidylinositol transfer protein, PITP 0.000000433
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T000212
Sequence length 274
Comment protein Name="PYU1_T000212" Note="Similar to Pitpnb: Phosphatidylinositol transfer protein beta isoform (Rattus norvegicus)" AED:0 QI:73|1|1|1|1|1|6|143|274
Sequence
MVMIHEFRVPLHMTVDEFQVAQLYMVVDASEKMTGDGEGVEILKNEPYDNTDGKMGVSEI
SGWTIPRTKGQYTRKHYYVKSKIPGFVSAFCPEDSMVLIEEAWNAYPHCVTVIVNGYLAK
NKFYICIESNHLPDSGDTENAVNMSNNELSNRTVEYLDIAQKLPKQTLKDDCDPSTYKSV
KTSRGPLQKGWQKKVSPVMTCYKAVRVNFEYWGVQGKAEKIIRDQQRQLFHHTLRQAQCL
TDDWFGLTMDDIRRLEENVAAKLEAKRLQGTSNQ
Download sequence
Identical sequences K3W5H1
PYU1_T000212

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]