SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T000237 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T000237
Domain Number 1 Region: 26-279
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 5.96e-94
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000507
Further Details:      
 
Domain Number 2 Region: 280-484
Classification Level Classification E-value
Superfamily Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 3.14e-63
Family Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 0.0000142
Further Details:      
 
Domain Number 3 Region: 616-776
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 2.88e-36
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.064
Further Details:      
 
Domain Number 4 Region: 545-612
Classification Level Classification E-value
Superfamily Translation proteins 0.00000000000000706
Family AlaX-M N-terminal domain-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T000237
Sequence length 978
Comment protein Name="PYU1_T000237" Note="Similar to ALATS: Alanyl-tRNA synthetase, mitochondrial (Arabidopsis thaliana)" AED:0.0112359550561798 QI:0|1|0|1|1|1|2|0|978
Sequence
MDQMEARVAQLEVSKAGPFSAVEWPAARIRQTFVDFFANHSVSPHTFYPSCPVVPLDDPT
LLFINAGMNQYKPIFLGQVDPSHPMAKLTRAVNSQKCIRAGGKHNDLDDVGKDVYHHTFF
EMLGNWSFGDYFKKEAVDMSFRLLTEVYGIDANRLYATYFGGDEKQGLPADEETRQIWLN
YLPAERVLPFGCKDNFWEMGDVGPCGPCTEIHYDRIGNRDASKLVNADLPDVIEIWNNVF
IQFNREADGKLVPLPSKHVDTGMGFERLASILQGKTSNYDTDVFTPLFAAIQKSTKAEPY
TGKLGAEDPTLRDMAYRVIADHIRTLTFAITDGAQPSNDGRGYVLRRILRRAVRYGQQFL
NAPSGFLSELVPVVVDMLHQAFPELQKKQKEVQEIILDEEQSFGRTLNKGIDRFKKIAQT
IRDSNKTVVPGEDAFFLYDSMGFPLDLTQIMAEEVGLTVDVKGYEEQMRLQSERSKMDRK
KGGNSGARPLVLEANETSQLTSKSIAPTDDSAKYESNTTLDAKVVAIFTTTESSSAFVDE
VKAGDFGRVGVILDKTPFYAQAGGQIYDTGVLTTATFKLDVDSVESYAGYVMHMGPIANG
SIKVGDSVQTQVDYARRSKIAPNHTMTHVLNFALRKVLGVNVDQRGSLVDETRLRFDFTA
NKALKPEQLYEVERICDDIIKQELEVFTQNSPQAHAKRIQGLRAVFGETYPDFVRVVSIG
QEIAPMLEDPENSKWSDYSVEFCGGTHMKNTKDAKKFVLYEEGAVAKGIRRVSAYTCELA
SEAEERAAKLQAQVDAIDKLSGNELSDAVAAFKPLLDVSLISLPTKDKFRKHVEVFVERI
KKYKKEAAAARAANGVRDASAEATKAKEAGQEIVVVKFDVGTDSKLGREMLEAMTNILPT
GSFMIVSTDADANKTAAFTQVSQHHVDTKQLDARQWVNHAMTVMNGKGGGKDAFNATGQA
KTVENADEAVALAKAYVQ
Download sequence
Identical sequences K3W5J6
PYU1_T000237

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]