SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T000276 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T000276
Domain Number 1 Region: 209-305
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000321
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0048
Further Details:      
 
Domain Number 2 Region: 44-185
Classification Level Classification E-value
Superfamily Bet v1-like 0.000000311
Family STAR domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T000276
Sequence length 341
Comment protein Name="PYU1_T000276" Note="Similar to PLEKHF2: Pleckstrin homology domain-containing family F member 2 (Homo sapiens)" AED:0.104105571847507 QI:0|-1|0|1|-1|0|1|0|341
Sequence
MEIEGYRLLQVTKAGVAIYEDATTISLDQKSARMRPRLVGVSAVKATLDEFTDTFGRDSD
DGFTLLNPDMHSCQKLHQIAAERERYIDINWLAMQPTWTGSMARRRDFVVLACEETFYTG
SQHNRRGWANMMHSVQLPWCPPLDKLSSIVRGSMHQTGVIVLESEASPEWLHVISIVEID
MKGNIADRSQRANALKRIGCLESIAPTIVKQRLQRMSLMRTKQFNAAKPTKESHCAVCTQ
RIGIPSLRLHHYCRKCSNSVCGTCSRNWQLDPNTKKKTRVCGLCIMATQKCTKSTDTSTT
NNDNDIVYDGDDDDVLKRNIPLMQRAVTDHRPSRAQAFLET
Download sequence
Identical sequences K3W5N5
PYU1_T000276

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]