SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T000321 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T000321
Domain Number 1 Region: 241-294
Classification Level Classification E-value
Superfamily UBA-like 0.0000000000000843
Family UBA domain 0.016
Further Details:      
 
Domain Number 2 Region: 28-170
Classification Level Classification E-value
Superfamily Rhomboid-like 0.0000693
Family Rhomboid-like 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T000321
Sequence length 295
Comment protein Name="PYU1_T000321" Note="Similar to UBAC2: Ubiquitin-associated domain-containing protein 2 (Macaca fascicularis)" AED:0.195185001295225 QI:0|0.37|0.33|0.44|0.87|0.88|9|0|295
Sequence
MHGDLRGFSSSASLIFDQGRLLTLEREAVLSRMQYWRLLTNQVTFHHGLAVSFGLYVMFQ
FRVIERQMGSRKFGSLVVFILSLTSGLELAALMSAPSLARQIPGGPYALLGALAVFFNKY
IPKLYPRSFSFSGLNFSDKSSTYLLLIVMLGRNPNTLLSFAPGALFGLLFSSTPLARLRL
PSFLLTTLGIFHPLFDVVPASVVALQRQRRVLEAQRRLGVRNNQQNMPAGQGFRDQLLPG
AGGGMLPPHMAAAPPSEDAIQQLMALGFDRERAITALQSTSNNVEAAANRLLNGL
Download sequence
Identical sequences K3W5T0
PYU1_T000321

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]