SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T000332 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T000332
Domain Number 1 Region: 45-105
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 7.06e-17
Family Canonical RBD 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T000332
Sequence length 128
Comment protein Name="PYU1_T000332" Note="Similar to Htatsf1: HIV Tat-specific factor 1 homolog (Mus musculus)" AED:0.150284808771254 QI:0|1|0|1|1|1|2|0|128
Sequence
MSSAPAAADNTAPLESESARLELPSKAIVLKYVWDPLAPQETTTFFDELEDDMRSECSKF
GAVEHVHIVADGSVLVRFHALESAIKCLQVMNGRWFDGRKIDARFDQSTPEEPNDADTKL
EAFLATIG
Download sequence
Identical sequences K3W5U1
PYU1_T000332

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]