SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T000358 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T000358
Domain Number 1 Region: 80-130
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000000366
Family Myb/SANT domain 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T000358
Sequence length 190
Comment protein Name="PYU1_T000358" Note="Similar to MYSM1: Protein MYSM1 (Gallus gallus)" AED:0.188345864661654 QI:0|-1|0|1|-1|0|1|0|190
Sequence
MPSPSFPAHNEQQDRTKSIRSKSMNGHNFFHHHPLKRTCDSAFPSQSSQVESREKSAKDK
TQSVTGNTLPASSAAASTHIGRWTKKEHELFIEGLKLYGKSWKKISSLVITRTLVQIRTH
AQKYLQKQSKNAQKAAAAAAASGSSSSASTNSSKARQQQRCGAQKQNGKHLDAWKGQRGL
VPISFPDILL
Download sequence
Identical sequences K3W5W7
PYU1_T000358

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]