SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T000367 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PYU1_T000367
Domain Number - Region: 89-139
Classification Level Classification E-value
Superfamily Leucine zipper domain 0.000563
Family Leucine zipper domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T000367
Sequence length 316
Comment protein Name="PYU1_T000367" Note="Protein of unknown function" AED:0.0524910257804851 QI:0|-1|0|1|-1|1|1|0|316
Sequence
MSGRQQEPQECVDEAAASELLLSVASQFLGGEKAKQSAKALPADDVFPSFQALVYAATSV
DHCDASVWKHDVVAAKTPKETRSVAESKTKLQTRRERNRISCRKTRIKRKMEQSGRKLVV
RKRAERNAYLSKILDELPQTQQIQSSYRVTERDTLARQFVAQSLHYQLIDEEYDASWCWK
SPVASHASSSSRRVKASCASSDQYTKPQDELIEQWRAIVADYEIVDVEIVRIREQSQEER
AAEPKSTSSDSIITVKCEWRFVGVPTRSRQSIQNESNSVIGETTLRFRGLGVEAATMCVI
AVTATASSSKDVTVRV
Download sequence
Identical sequences K3W5X6
PYU1_T000367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]