SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T000407 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T000407
Domain Number 1 Region: 190-284,397-494,898-1136
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 4.05e-53
Family Calcium ATPase, transmembrane domain M 0.02
Further Details:      
 
Domain Number 2 Region: 691-754,796-897
Classification Level Classification E-value
Superfamily HAD-like 5.5e-23
Family Meta-cation ATPase, catalytic domain P 0.004
Further Details:      
 
Domain Number 3 Region: 284-399
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 1.02e-16
Family Calcium ATPase, transduction domain A 0.0013
Further Details:      
 
Domain Number 4 Region: 506-709
Classification Level Classification E-value
Superfamily Metal cation-transporting ATPase, ATP-binding domain N 0.000000000000133
Family Metal cation-transporting ATPase, ATP-binding domain N 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T000407
Sequence length 1158
Comment protein Name="PYU1_T000407" Note="Similar to ATP13A4: Probable cation-transporting ATPase 13A4 (Homo sapiens)" AED:0.0711820534943917 QI:0|-1|0|1|-1|1|1|0|1158
Sequence
MAGLKELHVVPVADATGQRPDIVYAPNEFVRIVPYAFSWLRMLLYCVLVVCSGGLLFILS
VWLPHVFTHLARLRLPLSSLGQAHYMLILVHEDGSRSQWVEVKVQHPRATTSNDKPERCW
TRLFNRLKSCRKSGGDERSFDAIKKVKSSKHWVWFEFKKHRYAFNHEKGGYERYLATISE
DMQSITGRLASGLRGKDEVASRTTLHGSNVVDIDAPSVALLLFTKIMHPFYLFQIFSATV
WFIEEYTIYAAVILGLSAISMTWETYCEVSNTKRLRRMMQSDHQVDIIRDGKRATIHEKQ
LVPGDIVAVSAGAVCADMLLLEGICQVDEAIITGEELPVMKEPPTALEQITEVKVQAKAK
KSFLHAGSKVLRVGEGSKGCKAVVLSTGFATGKGELFRSILYPRQLTFEFERDSYRYLTV
LLAIAIAAFAKRAVDGDRIGNSFGYTIIHSLDLITIAVPPALPLVLSSGVSFALIRLRNR
GIACMDVRRINSCGQLSCFCFDKTGTLTDERLVFANAVNFHAADETNGTSLSAMSYTARD
KIPENLRLGMATCHELSVHVVDKVSTIRGSAVDEEMFAASLCRLDVADENKIIVNSVSDN
MVNHEIVKRFPFDASVQRSSVLIRNRETNEQQIWVKGSSEAIRSILTDVPSDLDKVASHC
AAEGFYCIAFAVKTIKDEDPPIDMNKRDEIEKGVEFVGFVNFINSLKPESNAVFKELYDA
EMDIRVITGDNAYTALHVCQQLEMKLKPRVAVVDVDAKTGDVMLYPTDQRDSNKLDDKWE
HFSGFNMSRLLNEYDIALTGAALDKLRIECEDESLRHLLSQTQIFARIRPLQKTWIVEQL
IDLGQTVGMCGDGTNDCGALKVAHVGLALLSGVEASMVAPFTSTKKCIQDVPVLIREGRC
AIVTSFLAFKFMVLYPLIQLAMATTLAHFDLALTNNQYLWDDMAIVLGLAITMLYTGAST
ELSKEKPPRTLFAPRIIASIAGQVAISIAFFAGHFALLRNQSTDWFCQIEDGMAFLSRSR
SEVPSNCEIYLDYNTPNSEYSFEDTCVWLFGHMLFISVAAAFNAKDPFRLPFYTNKTFTV
LFLAVLGVNLWFLLNTSDLLNDTFQLMPIPFDYRWKMLVMFAGHFIASILWELVATGLLP
KFSRPKWVQRVSKSCKFF
Download sequence
Identical sequences K3W616
PYU1_T000407

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]