SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T000408 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T000408
Domain Number 1 Region: 150-251,364-461,858-872
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 1.15e-26
Family Calcium ATPase, transmembrane domain M 0.021
Further Details:      
 
Domain Number 2 Region: 466-478,663-716,761-857
Classification Level Classification E-value
Superfamily HAD-like 2.23e-26
Family Meta-cation ATPase, catalytic domain P 0.0055
Further Details:      
 
Domain Number 3 Region: 250-366
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 0.00000000000000157
Family Calcium ATPase, transduction domain A 0.0015
Further Details:      
 
Domain Number 4 Region: 473-669
Classification Level Classification E-value
Superfamily Metal cation-transporting ATPase, ATP-binding domain N 0.000000000000392
Family Metal cation-transporting ATPase, ATP-binding domain N 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T000408
Sequence length 872
Comment protein Name="PYU1_T000408" Note="Similar to W08D2.5: Probable cation-transporting ATPase W08D2.5 (Caenorhabditis elegans)" AED:0.0408871382003755 QI:0|-1|0|1|-1|1|1|0|872
Sequence
MKSLQEHLVVPVDDYAGRRSQLVYAPNEHEKIVPYAYSAVRLALFWVLVVGTGGVFGIVS
IWFPQLFTWVARSRLPYSVIGDADFMLVLIHRDGFRSQYIEQKVHRPTHNVAEDRTKLPW
VWFEFKKHRYVYNHEKGEFERYLASICEDMTKIQARLNSGLDVNTASAKMELFGANLVDI
KKPRIPMLLFTKIVHPFYLFQVFSATVWFLQQYTVYAIVILVMSASSLTWEIYSEVSNSN
RLRSMVRSDRVVEVVRADRKLKIHETELVPGDVVVVVPGPMVADLLLLSGACVADEASLT
GEALPVNKEPAMGAGVLTEVDARTHYKASFLHAGSIITRVREASDECRGIVLSTGFSTGK
GELFRSIIFPKTITFEFERDSYRYLALLATIAFAAFLKRVIEGAKGGSTVGETIVNSLDL
FTIAVPPALPIVLSSGIGFALNRLKQGGIFCIDSQRINSCGQLSCFCFDKTGTLTQEHLT
LASVDVVDESSYKLQNVGLDIPATFKLAMATCHGLSEAEEGGLQGYSLDLAMFKASKYEL
EYLHGKSKGNYVAIATDTLSEGEGKRYGLVKRFSFDATCQTSSVIVEELDTKKRFVFVKG
SPEAIKSISTNAPEDLHHKTISYSAEGYYCIGFGVKEIDAIVALDLNNRQAVESGIRFEG
LAVFKNELKTESKGIIDELYVAEIDVRMITGDNALTAVHVARELEMKLKDKVAVVDLDEA
TGATVYLSVDSIATTDTMVWVPLNGGNFMQVKSEFSIAITGVALDKLHRDVGEGTMKQLL
SETLIFARIRPQQKAWIVEELMELGHIVGMCGDGTNDCGALKAAHVGLALSSAEASIVAP
FTSNSKAILDVPVLIREGRCALTTSFLGFKFM
Download sequence
Identical sequences K3W617
PYU1_T000408

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]