SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T000445 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T000445
Domain Number 1 Region: 619-747
Classification Level Classification E-value
Superfamily GAF domain-like 1.41e-16
Family GAF domain 0.052
Further Details:      
 
Domain Number 2 Region: 353-408
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000576
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.011
Further Details:      
 
Weak hits

Sequence:  PYU1_T000445
Domain Number - Region: 301-496
Classification Level Classification E-value
Superfamily ARM repeat 0.018
Family HEAT repeat 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T000445
Sequence length 759
Comment protein Name="PYU1_T000445" Note="Similar to Zfyve19: Zinc finger FYVE domain-containing protein 19 (Mus musculus)" AED:0.241643507183851 QI:0|-1|0|1|-1|1|1|0|759
Sequence
MDMHHSILQVHDAAPGGIVIKSPSGREKLVLTDEEICNDIFATIPKLHEAVARDTYGRRW
KQKCRENGVDVFELETASGVAGDEDLDLVHAVVAKVELRCHLNEVLNVLVNEDSTEYQTT
MQALCGKKFKRGENLFAQRRMFTAQNRVQAFDIVSQPNSSKSNGDLLENNPAHGLIAVKV
ATLRPKLSLKFKSKHRLKQRLALSSITQQYPGKDRAVHIIKTLPKSAHDQIIPAAERSAL
RRDLDHIAVGFNVQSTHRGGGSINHTTRVFAHGYASTTPPSSFGKMGSTKQLTSINAADL
ARHRDAVMNPEAKHVINLLTKSLRQFERVIRRRRFGFQSFIYFPMGYDDPILEKSCSICH
KHFSFFRRDFFCQLCGHMCCNDCSQLHEVEARIGEVRKNRVCLKCVVRVDSCVFEDEELL
KALGPIVVEVDDAQWLNDDNFYLADIDEDAETDTTSITSVTSSTGTNCSVDEIHDNLYSD
DPTLRSQALDFLGQLVGPEAKTSQKKHYDFVDPAAAHQYYTKKQRRAKSGKRKQQTKKQR
VLEDVENHLSQSLRDAKDKYHPEDFVVVGMERDYTLQFDSSKTRSADQPLPPRIARSKQV
KRLQFIEESGVLKPSFDHAALDLIAEVAAKRMNCPMGFISVVDQDTFHAIGTYNVPPEVF
NLPLENNVCVHQVHGEKPLVLKNPQRDMRFSQMPCVQDLGVKFYAGFPIRGPEGNVVASL
CAADAVPHNNITTKDYVTMEALAQLASELVVPSARQQKS
Download sequence
Identical sequences K3W654
PYU1_T000445

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]