SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T000450 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T000450
Domain Number 1 Region: 50-178
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.28e-28
Family Single strand DNA-binding domain, SSB 0.00026
Further Details:      
 
Domain Number 2 Region: 240-304
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000000734
Family C-terminal domain of RPA32 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T000450
Sequence length 305
Comment protein Name="PYU1_T000450" Note="Similar to RPA2: Replication protein A 32 kDa subunit (Pongo abelii)" AED:0.00490196078431371 QI:0|1|0|1|1|1|2|0|305
Sequence
MSYGGYEAYGNDDFGGGGFMEGSQGGSQSTPSKGRGGGGGGRASRDAQTLLPITAKQLAS
RNASDDDVIRIDNQEVTNVKMVGILSNVVPHSTNVNFQLDDGTGIIDGRMFLHADDADLA
ESEIAKLRDGIYVRVVGNLRTFQEKVSLSAFSVTPIEDFNEITHHFLDAIYVHCYNTKGP
LQSSGGAAGANAFGTPVKGSSSGFDAPLAGQQTWNQGSSTYLGHSGSMGGGMDYGMMDSN
FSPEQKAILDVLGTCTSDRGLKIDQIFLELRGQMSEDQLRGALNYLTSEGHVYSTIDENH
FKRTA
Download sequence
Identical sequences K3W659
PYU1_T000450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]